Western Blot (WB)
(Western Blot analysis of H2AFY2 expression in transfected 293T cell line by H2AFY2 polyclonal antibody. Lane 1: H2AFY2 transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human H2AFY2 Polyclonal Antibody | anti-H2AFY2 antibody
H2AFY2 (Core histone Macro-H2A.2, Histone macroH2A2, mH2A2, MACROH2A2) (PE)
Gene Names
H2AFY2; macroH2A2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
H2AFY2; Polyclonal Antibody; H2AFY2 (Core histone Macro-H2A.2; Histone macroH2A2; mH2A2; MACROH2A2) (PE); anti-H2AFY2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human H2AFY2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-H2AFY2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human H2AFY2, aa1-372 (NP_061119.1).
Immunogen Sequence
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of H2AFY2 expression in transfected 293T cell line by H2AFY2 polyclonal antibody. Lane 1: H2AFY2 transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of H2AFY2 expression in transfected 293T cell line by H2AFY2 polyclonal antibody. Lane 1: H2AFY2 transfected lysate (40.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-H2AFY2 antibody
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation.
Product Categories/Family for anti-H2AFY2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,058 Da
NCBI Official Full Name
core histone macro-H2A.2
NCBI Official Synonym Full Names
H2A histone family, member Y2
NCBI Official Symbol
H2AFY2
NCBI Official Synonym Symbols
macroH2A2
NCBI Protein Information
core histone macro-H2A.2; core histone macroH2A2.2; mH2A2
Protein Family
Similar Products
Product Notes
The H2AFY2 (Catalog #AAA6380692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The H2AFY2 (Core histone Macro-H2A.2, Histone macroH2A2, mH2A2, MACROH2A2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's H2AFY2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the H2AFY2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "H2AFY2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
