Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GUK1 rabbit polyclonal antibody. Western Blot analysis of GUK1 expression in human spleen.)

Rabbit anti-Human GUK1 Polyclonal Antibody | anti-GUK1 antibody

GUK1 (Guanylate Kinase, GMP Kinase, GMK) (FITC)

Gene Names
GUK1; GMK
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GUK1; Polyclonal Antibody; GUK1 (Guanylate Kinase; GMP Kinase; GMK) (FITC); anti-GUK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GUK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-GUK1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GUK1, aa1-197 (NP_000849.1).
Immunogen Sequence
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GUK1 rabbit polyclonal antibody. Western Blot analysis of GUK1 expression in human spleen.)

Western Blot (WB) (GUK1 rabbit polyclonal antibody. Western Blot analysis of GUK1 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of GUK1 expression in transfected 293T cell line by GUK1 polyclonal antibody. Lane 1: GUK1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GUK1 expression in transfected 293T cell line by GUK1 polyclonal antibody. Lane 1: GUK1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GUK1 antibody
Guanylate kinase catalyzes the transfer of phosphate from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) or dGMP. This enzyme functions in the recovery of cGMP and is, therefore, thought to regulate the supply of guanine nucleotides to signal transduction pathways. The GUK2 and GUK3 isoforms are determined by separate loci. Brady et al. (1996) cloned human and mouse cDNAs of GUK1. They stated that the guanylate kinases are targets for cancer chemotherapy and are inhibited by the antitumor drug 6-thioguanine. They reported that the human gene codes for a protein of 197aa with a mass of 21.7kD. They found that the 1-kb message was ubiquitously expressed.
Product Categories/Family for anti-GUK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,596 Da
NCBI Official Full Name
guanylate kinase isoform b
NCBI Official Synonym Full Names
guanylate kinase 1
NCBI Official Symbol
GUK1
NCBI Official Synonym Symbols
GMK
NCBI Protein Information
guanylate kinase; ATP:GMP phosphotransferase; GMP kinase
UniProt Protein Name
Guanylate kinase
UniProt Gene Name
GUK1
UniProt Synonym Gene Names
GMK
UniProt Entry Name
KGUA_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

GUK1: Essential for recycling GMP and indirectly, cGMP. Belongs to the guanylate kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; EC 2.7.4.8; Kinase, other

Chromosomal Location of Human Ortholog: 1q32-q41

Cellular Component: cytosol

Molecular Function: guanylate kinase activity; ATP binding

Biological Process: ATP metabolic process; dATP metabolic process; dGMP metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; GDP biosynthetic process; GDP-mannose metabolic process; drug metabolic process; GMP metabolic process; dGDP biosynthetic process; purine nucleotide metabolic process; nucleotide phosphorylation

Research Articles on GUK1

Similar Products

Product Notes

The GUK1 guk1 (Catalog #AAA6380630) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUK1 (Guanylate Kinase, GMP Kinase, GMK) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GUK1 guk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GUK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.