Rabbit anti-Human GUK1 Polyclonal Antibody | anti-GUK1 antibody

GUK1 (Guanylate Kinase, GMP Kinase, GMK) (Biotin)

Cat. Num. AAA6380629

• Gene Names: GUK1; GMK
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GUK1; Polyclonal Antibody; GUK1 (Guanylate Kinase; GMP Kinase; GMK) (Biotin); anti-GUK1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GUK1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GUK1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GUK1, aa1-197 (NP_000849.1).
• Immunogen Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GUK1 rabbit polyclonal antibody. Western Blot analysis of GUK1 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of GUK1 expression in transfected 293T cell line by GUK1 polyclonal antibody. Lane 1: GUK1 transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GUK1 antibody

Guanylate kinase catalyzes the transfer of phosphate from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) or dGMP. This enzyme functions in the recovery of cGMP and is, therefore, thought to regulate the supply of guanine nucleotides to signal transduction pathways. The GUK2 and GUK3 isoforms are determined by separate loci. Brady et al. (1996) cloned human and mouse cDNAs of GUK1. They stated that the guanylate kinases are targets for cancer chemotherapy and are inhibited by the antitumor drug 6-thioguanine. They reported that the human gene codes for a protein of 197aa with a mass of 21.7kD. They found that the 1-kb message was ubiquitously expressed.

Product Categories/Family for anti-GUK1 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4504221
• NCBI GeneID: 2987
• NCBI Accession #: NP_000849.1
• NCBI GenBank Nucleotide #: NM_000858.4
• UniProt Accession #: Q16774; B1ANH1
• Molecular Weight: 26,596 Da
• NCBI Official Full Name: guanylate kinase isoform b
• NCBI Official Synonym Full Names: guanylate kinase 1
• NCBI Official Symbol: GUK1
• NCBI Official Synonym Symbols: GMK
• NCBI Protein Information: guanylate kinase; ATP:GMP phosphotransferase; GMP kinase
• UniProt Protein Name: Guanylate kinase
• UniProt Gene Name: GUK1
• UniProt Synonym Gene Names: GMK
• UniProt Entry Name: KGUA_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Uniprot Description

GUK1: Essential for recycling GMP and indirectly, cGMP. Belongs to the guanylate kinase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleotide Metabolism - purine; EC 2.7.4.8; Kinase, other

Chromosomal Location of Human Ortholog: 1q32-q41

Cellular Component: cytosol

Molecular Function: guanylate kinase activity; ATP binding

Biological Process: ATP metabolic process; dATP metabolic process; dGMP metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; GDP biosynthetic process; GDP-mannose metabolic process; drug metabolic process; GMP metabolic process; dGDP biosynthetic process; purine nucleotide metabolic process; nucleotide phosphorylation