Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GUCA2B expression in transfected 293T cell line by GUCA2B polyclonal antibody. Lane 1: GUCA2B transfected lysate (12.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GUCA2B Polyclonal Antibody | anti-GUCA2B antibody

GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin) (PE)

Gene Names
GUCA2B; UGN; GCAP-II
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GUCA2B; Polyclonal Antibody; GUCA2B (Guanylate Cyclase Activator 2B; Guanylate Cyclase C-activating Peptide 2; Guanylate Cyclase C-activating Peptide II; Uroguanylin) (PE); anti-GUCA2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GUCA2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GUCA2B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GUCA2B, aa1-112 (NP_009033.1).
Immunogen Sequence
MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GUCA2B expression in transfected 293T cell line by GUCA2B polyclonal antibody. Lane 1: GUCA2B transfected lysate (12.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GUCA2B expression in transfected 293T cell line by GUCA2B polyclonal antibody. Lane 1: GUCA2B transfected lysate (12.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GUCA2B antibody
Uroguanylin and guanylin (GUCA2A; MIM 139392), peptide homologs of the bacterial heat-stable enterotoxins (e.g., the E. coli ST toxin; STa), are endogenous activators of the guanylate cyclase-2C receptor (GUCY2C; MIM 601330), which synthesizes cyclic GMP (cGMP), a key component of several intracellular signal transduction pathways.
Product Categories/Family for anti-GUCA2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,069 Da
NCBI Official Full Name
guanylate cyclase activator 2B
NCBI Official Synonym Full Names
guanylate cyclase activator 2B (uroguanylin)
NCBI Official Symbol
GUCA2B
NCBI Official Synonym Symbols
UGN; GCAP-II
NCBI Protein Information
guanylate cyclase activator 2B; prepro-uroguanylin
UniProt Protein Name
Guanylate cyclase activator 2B
UniProt Gene Name
GUCA2B
UniProt Synonym Gene Names
GCAP-II; UGN
UniProt Entry Name
GUC2B_HUMAN

NCBI Description

This gene encodes a member of the guanylin family, and is expressed in the stomach and intestine. This protein functions as an endogenous ligand for the guanylate cyclase-C receptor and stimulates an increase in cyclic GMP, a key component of several intracellular signal transduction pathways. It maybe involved in salt and water secretion into the intestinal lumen as well as the renal tubules, and thus regulate electrolyte homeostasis in these tissues. [provided by RefSeq, Oct 2011]

Uniprot Description

GUCA2B: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Belongs to the guanylin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1p34-p33

Molecular Function: calcium sensitive guanylate cyclase activator activity

Biological Process: cGMP biosynthetic process; positive regulation of guanylate cyclase activity; negative regulation of blood pressure; body fluid secretion; excretion

Research Articles on GUCA2B

Similar Products

Product Notes

The GUCA2B guca2b (Catalog #AAA6380615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GUCA2B guca2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GUCA2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.