Western Blot (WB)
(WB Suggested Anti-GTSE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGTSE1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Rabbit GTSE1 Polyclonal Antibody | anti-GTSE1 antibody
GTSE1 antibody - N-terminal region
Gene Names
GTSE1; B99
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GTSE1; Polyclonal Antibody; GTSE1 antibody - N-terminal region; anti-GTSE1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNPVPEQPPLPTSESPFAWSPLAGEKFVEVYKEAHLLALHIESSSRNQAA
Sequence Length
720
Applicable Applications for anti-GTSE1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTSE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GTSE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGTSE1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Western Blot (WB)
(WB Suggested Anti-GTSE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateGTSE1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-GTSE1 antibody
This is a rabbit polyclonal antibody against GTSE1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.
Target Description: GTSE1 is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis.
Product Categories/Family for anti-GTSE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
G2 and S phase-expressed protein 1
NCBI Official Synonym Full Names
G2 and S-phase expressed 1
NCBI Official Symbol
GTSE1
NCBI Official Synonym Symbols
B99
NCBI Protein Information
G2 and S phase-expressed protein 1
UniProt Protein Name
G2 and S phase-expressed protein 1
Protein Family
UniProt Gene Name
GTSE1
UniProt Synonym Gene Names
GTSE-1
UniProt Entry Name
GTSE1_HUMAN
NCBI Description
The protein encoded by this gene is only expressed in the S and G2 phases of the cell cycle, where it colocalizes with cytoplasmic tubulin and microtubules. In response to DNA damage, the encoded protein accumulates in the nucleus and binds the tumor suppressor protein p53, shuttling it out of the nucleus and repressing its ability to induce apoptosis. [provided by RefSeq, Jul 2008]
Uniprot Description
GTSE1: May be involved in p53-induced cell cycle arrest in G2/M phase by interfering with microtubule rearrangements that are required to enter mitosis. Overexpression delays G2/M phase progression.
Protein type: Apoptosis; Cell cycle regulation
Chromosomal Location of Human Ortholog: 22q13.2-q13.3
Cellular Component: membrane; cytoplasmic microtubule
Molecular Function: protein binding
Biological Process: DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; microtubule-based process
Research Articles on GTSE1
Similar Products
Product Notes
The GTSE1 gtse1 (Catalog #AAA3206396) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTSE1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTSE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GTSE1 gtse1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNPVPEQPPL PTSESPFAWS PLAGEKFVEV YKEAHLLALH IESSSRNQAA. It is sometimes possible for the material contained within the vial of "GTSE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
