Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GTPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
Rabbit anti-Human, Mouse GTPBP1 Polyclonal Antibody | anti-GTPBP1 antibody
GTPBP1 Polyclonal Antibody
Gene Names
GTPBP1; GP1; GP-1; HSPC018
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GTPBP1; Polyclonal Antibody; GTPBP1 Polyclonal Antibody; GP-1; GP1; HSPC018; anti-GTPBP1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELDLTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTV
Sequence Length
669
Applicable Applications for anti-GTPBP1 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human GTPBP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
U-251MG, Jurkat, HeLa, LO2, Mouse thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GTPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using GTPBP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.)
Related Product Information for anti-GTPBP1 antibody
This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype.
Product Categories/Family for anti-GTPBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 72kDa
Observed: 72kDa
Observed: 72kDa
NCBI Official Full Name
GTP-binding protein 1
NCBI Official Synonym Full Names
GTP binding protein 1
NCBI Official Symbol
GTPBP1
NCBI Official Synonym Symbols
GP1; GP-1; HSPC018
NCBI Protein Information
GTP-binding protein 1
UniProt Protein Name
GTP-binding protein 1
Protein Family
UniProt Gene Name
GTPBP1
UniProt Synonym Gene Names
G-protein 1; GP-1; GP1
NCBI Description
This gene is upregulated by interferon-gamma and encodes a protein that is a member of the AGP11/GTPBP1 family of GTP-binding proteins. A structurally similar protein has been found in mouse, where disruption of the gene for that protein had no observable phenotype. [provided by RefSeq, Jul 2008]
Uniprot Description
Promotes degradation of target mRNA species. Plays a role in the regulation of circadian mRNA stability. Binds GTP and has GTPase activity ().
Similar Products
Product Notes
The GTPBP1 gtpbp1 (Catalog #AAA9135345) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTPBP1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the GTPBP1 gtpbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDSPVPASMF APEPSSPGAA RAAAAAARLH GGFDSDCSED GEALNGEPEL DLTSKLVLVS PTSEQYDSLL RQMWERMDEG CGETIYVIGQ GSDGTEYGLS EADMEASYAT VKSMAEQIEA DVILLRERQE AGGRVRDYLV RKRVGDNDFL EVRVAVVGNV DAGKSTLLGV LTHGELDNGR GFARQKLFRH KHEIESGRTS SVGNDILGFD SEGNVVNKPD SHGGSLEWTK ICEKSTKVIT FIDLAGHEKY LKTTV. It is sometimes possible for the material contained within the vial of "GTPBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
