Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-GTF21 AntibodyParaffin Embedded Tissue: Human PancreasCellular Data: Epithelial cells of pancreatic acinusAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit GTF2I Polyclonal Antibody | anti-GTF2I antibody

GTF2I antibody - N-terminal region

Gene Names
GTF2I; WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
GTF2I; Polyclonal Antibody; GTF2I antibody - N-terminal region; anti-GTF2I antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH
Sequence Length
957
Applicable Applications for anti-GTF2I antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GTF2I
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GTF21 AntibodyParaffin Embedded Tissue: Human PancreasCellular Data: Epithelial cells of pancreatic acinusAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-GTF21 AntibodyParaffin Embedded Tissue: Human PancreasCellular Data: Epithelial cells of pancreatic acinusAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-GTF21 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-GTF21 AntibodyParaffin Embedded Tissue: Human SkinCellular Data: Squamous epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2There is BioGPS gene expression data showing that GTF2I is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-GTF2I Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2There is BioGPS gene expression data showing that GTF2I is expressed in HepG2)

Western Blot (WB)

(WB Suggested Anti-GTF2I AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole CellThere is BioGPS gene expression data showing that GTF2I is expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-GTF2I AntibodyTitration: 2.5 ug/mlPositive Control: HepG2 Whole CellThere is BioGPS gene expression data showing that GTF2I is expressed in HepG2)
Related Product Information for anti-GTF2I antibody
This is a rabbit polyclonal antibody against GTF2I. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GTF2I is a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23.This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5' UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
108kDa
NCBI Official Full Name
general transcription factor II-I isoform 4
NCBI Official Synonym Full Names
general transcription factor IIi
NCBI Official Symbol
GTF2I
NCBI Official Synonym Symbols
WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
NCBI Protein Information
general transcription factor II-I

NCBI Description

This gene encodes a phosphoprotein containing six characteristic repeat motifs. The encoded protein binds to the initiator element (Inr) and E-box element in promoters and functions as a regulator of transcription. This locus, along with several other neighboring genes, is deleted in Williams-Beuren syndrome. There are many closely related genes and pseudogenes for this gene on chromosome 7. This gene also has pseudogenes on chromosomes 9, 13, and 21. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2013]

Research Articles on GTF2I

Similar Products

Product Notes

The GTF2I (Catalog #AAA3200638) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2I antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2I can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GTF2I for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ILSPGGSCGP IKVKTEPTED SGISLEMAAV TVKEESEDPD YYQYNIQGSH. It is sometimes possible for the material contained within the vial of "GTF2I, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.