Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GTF2H3 expression in transfected 293T cell line by GTF2H3 polyclonal antibody. Lane 1: GTF2H3 transfected lysate (33.88kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GTF2H3 Polyclonal Antibody | anti-GTF2H3 antibody

GTF2H3 (General Transcription Factor IIH Subunit 3, Basic Transcription Factor 2 34kD Subunit, General Transcription Factor IIH Polypeptide 3, TFIIH Basal Transcription Factor Complex p34 Subunit)

Gene Names
GTF2H3; P34; BTF2; TFB4; TFIIH
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GTF2H3; Polyclonal Antibody; GTF2H3 (General Transcription Factor IIH Subunit 3; Basic Transcription Factor 2 34kD Subunit; General Transcription Factor IIH Polypeptide 3; TFIIH Basal Transcription Factor Complex p34 Subunit); Anti -GTF2H3 (General Transcription Factor IIH Subunit 3; anti-GTF2H3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GTF2H3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKLKVSA
Applicable Applications for anti-GTF2H3 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GTF2H3, aa1-308 (NP_001507.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GTF2H3 expression in transfected 293T cell line by GTF2H3 polyclonal antibody. Lane 1: GTF2H3 transfected lysate (33.88kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GTF2H3 expression in transfected 293T cell line by GTF2H3 polyclonal antibody. Lane 1: GTF2H3 transfected lysate (33.88kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GTF2H3 antibody
Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB.
Product Categories/Family for anti-GTF2H3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,378 Da
NCBI Official Full Name
GTF2H3 protein, partial
NCBI Official Synonym Full Names
general transcription factor IIH, polypeptide 3, 34kDa
NCBI Official Symbol
GTF2H3
NCBI Official Synonym Symbols
P34; BTF2; TFB4; TFIIH
NCBI Protein Information
general transcription factor IIH subunit 3; basic transcription factor 2 34 kDa subunit; TFIIH basal transcription factor complex p34 subunit
UniProt Protein Name
General transcription factor IIH subunit 3
UniProt Gene Name
GTF2H3
UniProt Synonym Gene Names
BTF2 p34
UniProt Entry Name
TF2H3_HUMAN

NCBI Description

This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision repair and associates with the Cdk-activating kinase complex. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 14. [provided by RefSeq, Dec 2012]

Uniprot Description

GTF2H3: Component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Anchors XPB. Belongs to the TFB4 family.

Protein type: Transcription factor; DNA repair, damage

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: nucleoplasm; holo TFIIH complex

Molecular Function: RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; translation factor activity, nucleic acid binding; metal ion binding; damaged DNA binding; protein N-terminus binding; transcription factor activity; protein kinase activity

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; translation; viral reproduction; positive regulation of viral transcription; transcription from RNA polymerase I promoter; RNA elongation from RNA polymerase I promoter; DNA repair; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; protein amino acid phosphorylation; mRNA capping; regulation of transcription, DNA-dependent; negative regulation of gene expression, epigenetic; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; nucleotide-excision repair, DNA damage removal; gene expression; transcription initiation from RNA polymerase I promoter

Research Articles on GTF2H3

Similar Products

Product Notes

The GTF2H3 gtf2h3 (Catalog #AAA641322) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTF2H3 (General Transcription Factor IIH Subunit 3, Basic Transcription Factor 2 34kD Subunit, General Transcription Factor IIH Polypeptide 3, TFIIH Basal Transcription Factor Complex p34 Subunit) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2H3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GTF2H3 gtf2h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVSDEDELNL LVIVVDANPI WWGKQALKES QFTLSKCIDA VMVLGNSHLF MNRSNKLAVI ASHIQESRFL YPGKNGRLGD FFGDPGNPPE FNPSGSKDGK YELLTSANEV IVEEIKDLMT KSDIKGQHTE TLLAGSLAKA LCYIHRMNKE VKDNQEMKSR ILVIKAAEDS ALQYMNFMNV IFAAQKQNIL IDACVLDSDS GLLQQACDIT GGLYLKVPQM PSLLQYLLWV FLPDQDQRSQ LILPPPVHVD YRAACFCHRN LIEIGYVCSV CLSIFCNFSP ICTTCETAFK ISLPPVLKAK KKKLKVSA. It is sometimes possible for the material contained within the vial of "GTF2H3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.