Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human GTF2A1 Polyclonal Antibody | anti-GTF2A1 antibody

GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (MaxLight 550)

Gene Names
GTF2A1; TF2A1; TFIIA; TFIIAL; TFIIA-42
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GTF2A1; Polyclonal Antibody; GTF2A1 (Transcription Initiation Factor IIA Subunit 1; General Transcription Factor IIA Subunit 1; TFIIAL; Transcription Initiation Factor TFIIA 42kD Subunit; TFIIA-42; TF2A1; MGC129969; MGC129970) (MaxLight 550); anti-GTF2A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GTF2A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-GTF2A1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GTF2A1, aa1-376 (NP_056943.1).
Immunogen Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GTF2A1 antibody
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Product Categories/Family for anti-GTF2A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,514 Da
NCBI Official Full Name
transcription initiation factor IIA subunit 1 isoform 1
NCBI Official Synonym Full Names
general transcription factor IIA, 1, 19/37kDa
NCBI Official Symbol
GTF2A1
NCBI Official Synonym Symbols
TF2A1; TFIIA; TFIIAL; TFIIA-42
NCBI Protein Information
transcription initiation factor IIA subunit 1; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; glucose regulated protein, 58kD pseudogene; transcription initiation factor TFIIA 42 kDa subunit
UniProt Protein Name
Transcription initiation factor IIA subunit 1
UniProt Gene Name
GTF2A1
UniProt Synonym Gene Names
TF2A1; TFIIA-42
UniProt Entry Name
TF2AA_HUMAN

NCBI Description

Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]

Uniprot Description

GTF2A1: a general transcription factor that plays an important role in transcriptional activation. A component of the transcription machinery of RNA polymerase II. Phosphorylated by Taf(II) 250 on serines that regulate TBP binding. Interacts with TBP (the TATA-binding protein). Two isoforms, 42 kDa and 37 kDa, are produced by alternative initiation.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q31.1

Cellular Component: nucleoplasm; cytoplasm; transcription factor TFIIA complex

Molecular Function: protein binding; DNA binding; TATA-binding protein binding; protein heterodimerization activity; transcription coactivator activity; transcription factor binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; regulation of transcription, DNA-dependent; viral reproduction; RNA elongation from RNA polymerase II promoter; gene expression

Research Articles on GTF2A1

Similar Products

Product Notes

The GTF2A1 gtf2a1 (Catalog #AAA6380491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTF2A1 (Transcription Initiation Factor IIA Subunit 1, General Transcription Factor IIA Subunit 1, TFIIAL, Transcription Initiation Factor TFIIA 42kD Subunit, TFIIA-42, TF2A1, MGC129969, MGC129970) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTF2A1 gtf2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTF2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.