Rabbit anti-Human GSTA3 Polyclonal Antibody | anti-GSTA3 antibody

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (AP)

Cat. Num. AAA6380374

• Gene Names: GSTA3; GTA3; GSTA3-3
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GSTA3; Polyclonal Antibody; GSTA3 (Glutathione S-transferase A3; GST Class-alpha Member 3; Glutathione S-transferase A3-3; MGC22232) (AP); anti-GSTA3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GSTA3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 918

• Applicable Applications for anti-GSTA3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GSTA3, aa1-222 (AAH20619.1).
• Immunogen Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GSTA3 rabbit polyclonal antibody. Western Blot analysis of GSTA3 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of GSTA3 expression in transfected 293T cell line by GSTA3 polyclonal antibody. Lane 1: GSTA3 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-GSTA3 antibody

Antibodies; Epitope Tag; GST

NCBI and Uniprot Product Information

• NCBI GI #: 18089047
• NCBI GeneID: 2940
• NCBI Official Full Name: Homo sapiens glutathione S-transferase alpha 3, mRNA
• NCBI Official Synonym Full Names: glutathione S-transferase alpha 3
• NCBI Official Symbol: GSTA3
• NCBI Official Synonym Symbols: GTA3; GSTA3-3
• NCBI Protein Information: glutathione S-transferase A3
• Protein Family: Glutathione S-transferase

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]