Mouse anti-Human GSTA3 Monoclonal Antibody | anti-GSTA3 antibody

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (AP)

Cat. Num. AAA6131579

• Gene Names: GSTA3; GTA3; GSTA3-3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography
• Synonyms: GSTA3; Monoclonal Antibody; GSTA3 (Glutathione S-transferase A3; GST Class-alpha Member 3; Glutathione S-transferase A3-3; MGC22232) (AP); anti-GSTA3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1F11
• Specificity: Recognizes human GSTA3.
• Purity/Purification: Purified by Protein A Affinity Chromatography
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-GSTA3 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-222 from human GSTA3 (AAH20619) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.16kD).)

Western Blot (WB)

(GSTA3 monoclonal antibody, Western Blot analysis of GSTA3 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSTA3 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-GSTA3 antibody

Antibodies; Epitope Tag; GST

NCBI and Uniprot Product Information

• NCBI GI #: 18089047
• NCBI GeneID: 2940
• Molecular Weight: 25,302 Da
• NCBI Official Full Name: Homo sapiens glutathione S-transferase alpha 3, mRNA
• NCBI Official Synonym Full Names: glutathione S-transferase alpha 3
• NCBI Official Symbol: GSTA3
• NCBI Official Synonym Symbols: GTA3; GSTA3-3
• NCBI Protein Information: glutathione S-transferase A3
• Protein Family: Glutathione S-transferase

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]