Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (50.16kD).)

Mouse anti-Human GSTA3 Monoclonal Antibody | anti-GSTA3 antibody

GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (AP)

Gene Names
GSTA3; GTA3; GSTA3-3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography
Synonyms
GSTA3; Monoclonal Antibody; GSTA3 (Glutathione S-transferase A3; GST Class-alpha Member 3; Glutathione S-transferase A3-3; MGC22232) (AP); anti-GSTA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes human GSTA3.
Purity/Purification
Purified by Protein A Affinity Chromatography
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GSTA3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-222 from human GSTA3 (AAH20619) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (50.16kD).)

Western Blot (WB) (Western Blot detection against Immunogen (50.16kD).)

Western Blot (WB)

(GSTA3 monoclonal antibody, Western Blot analysis of GSTA3 expression in HepG2.)

Western Blot (WB) (GSTA3 monoclonal antibody, Western Blot analysis of GSTA3 expression in HepG2.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GSTA3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GSTA3 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GSTA3 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GSTA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,302 Da
NCBI Official Full Name
Homo sapiens glutathione S-transferase alpha 3, mRNA
NCBI Official Synonym Full Names
glutathione S-transferase alpha 3
NCBI Official Symbol
GSTA3
NCBI Official Synonym Symbols
GTA3; GSTA3-3
NCBI Protein Information
glutathione S-transferase A3
Protein Family

NCBI Description

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on GSTA3

Similar Products

Product Notes

The GSTA3 (Catalog #AAA6131579) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GSTA3 (Glutathione S-transferase A3, GST Class-alpha Member 3, Glutathione S-transferase A3-3, MGC22232) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GSTA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GSTA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GSTA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.