Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GSHBSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit GSS Polyclonal Antibody | anti-GSS antibody

GSS Antibody - C-terminal region

Gene Names
GSS; GSHS; HEL-S-64p; HEL-S-88n
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
GSS; Polyclonal Antibody; GSS Antibody - C-terminal region; anti-GSS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPG
Sequence Length
474
Applicable Applications for anti-GSS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 75%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSHB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GSHBSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GSHBSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GSS antibody
This is a rabbit polyclonal antibody against GSHB. It was validated on Western Blot

Target Description: Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.
Product Categories/Family for anti-GSS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Synonym Full Names
glutathione synthetase
NCBI Official Symbol
GSS
NCBI Official Synonym Symbols
GSHS; HEL-S-64p; HEL-S-88n
NCBI Protein Information
glutathione synthetase
UniProt Protein Name
Glutathione synthetase
Protein Family
UniProt Gene Name
GSS
UniProt Synonym Gene Names
GSH synthetase; GSH-S
UniProt Entry Name
GSHB_HUMAN

NCBI Description

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

GSS: Defects in GSS are the cause of glutathione synthetase deficiency (GSS deficiency); also known as 5- oxoprolinuria or pyroglutamic aciduria. It is a severe form characterized by an increased rate of hemolysis and defective function of the central nervous system. Defects in GSS are the cause of glutathione synthetase deficiency of erythrocytes (GLUSYNDE)[MIM:231900]. Glutathione synthetase deficiency of erythrocytes is a mild form causing hemolytic anemia. Belongs to the eukaryotic GSH synthase family.

Protein type: EC 6.3.2.3; Other Amino Acids Metabolism - glutathione; Ligase

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: cytosol

Molecular Function: protein homodimerization activity; glutathione binding; glycine binding; magnesium ion binding; glutathione synthase activity; ATP binding

Biological Process: amino acid metabolic process; response to nutrient levels; nervous system development; response to cadmium ion; xenobiotic metabolic process; glutathione biosynthetic process; response to oxidative stress; response to amino acid stimulus; aging

Disease: Glutathione Synthetase Deficiency; Glutathione Synthetase Deficiency Of Erythrocytes, Hemolytic Anemia Due To

Research Articles on GSS

Similar Products

Product Notes

The GSS gss (Catalog #AAA3211588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSS Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GSS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSS gss for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRDGYMPRQY SLQNWEARLL LERSHAAKCP DIATQLAGTK KVQQELSRPG. It is sometimes possible for the material contained within the vial of "GSS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.