Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GSAPSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit GSAP Polyclonal Antibody | anti-GSAP antibody

GSAP Antibody - N-terminal region

Gene Names
GSAP; PION
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
GSAP; Polyclonal Antibody; GSAP Antibody - N-terminal region; anti-GSAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTRQNELLYTFEKDLQVFSCSVNSERTLLAASLVQSTKEGKRNELQPGSK
Sequence Length
854
Applicable Applications for anti-GSAP antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GSAP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GSAPSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GSAPSample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GSAP antibody
This is a rabbit polyclonal antibody against GSAP. It was validated on Western Blot

Target Description: Accumulation of neurotoxic amyloid-beta is a major hallmark of Alzheimer disease. Formation of amyloid-beta is catalyzed by gamma-secretase, a protease with numerous substrates. PION, or GSAP, selectively increases amyloid-beta production through a mechanism involving its interaction with both gamma-secretase and its substrate, the amyloid-beta precursor protein C-terminal fragment (APP-CTF).
Product Categories/Family for anti-GSAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
gamma-secretase-activating protein isoform a
NCBI Official Synonym Full Names
gamma-secretase activating protein
NCBI Official Symbol
GSAP
NCBI Official Synonym Symbols
PION
NCBI Protein Information
gamma-secretase-activating protein
UniProt Protein Name
Gamma-secretase-activating protein
UniProt Gene Name
GSAP
UniProt Synonym Gene Names
PION; GSAP; GSAP-16K
UniProt Entry Name
GSAP_HUMAN

NCBI Description

Accumulation of neurotoxic amyloid-beta is a major hallmark of Alzheimer disease (AD; MIM 104300). Formation of amyloid-beta is catalyzed by gamma-secretase (see PSEN1; MIM 104311), a protease with numerous substrates. PION, or GSAP, selectively increases amyloid-beta production through a mechanism involving its interaction with both gamma-secretase and its substrate, the amyloid-beta precursor protein (APP; MIM 104760) C-terminal fragment (APP-CTF) (He et al., 2010 [PubMed 20811458]).[supplied by OMIM, Nov 2010]

Uniprot Description

GSAP: Regulator of gamma-secretase activity, which specifically activates the production of beta-amyloid protein (beta-amyloid protein 40 and beta-amyloid protein 42), without affecting the cleavage of other gamma-secretase targets such has Notch. The gamma-secretase complex is an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta-amyloid precursor protein). Specifically promotes the gamma-cleavage of APP CTF-alpha (also named APP-CTF) by the gamma-secretase complex to generate beta- amyloid, while it reduces the epsilon-cleavage of APP CTF-alpha, leading to a low production of AICD. Belongs to the GSAP family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Activator

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: trans-Golgi network

Molecular Function: beta-amyloid binding

Biological Process: regulation of proteolysis

Research Articles on GSAP

Similar Products

Product Notes

The GSAP gsap (Catalog #AAA3209173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSAP Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GSAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GSAP gsap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTRQNELLYT FEKDLQVFSC SVNSERTLLA ASLVQSTKEG KRNELQPGSK. It is sometimes possible for the material contained within the vial of "GSAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.