SDS-PAGE
GrpE protein homolog 1, mitochondrial (GRPEL1) Recombinant Protein | GRPEL1 recombinant protein
Recombinant Human GrpE protein homolog 1, mitochondrial (GRPEL1)
Gene Names
GRPEL1; HMGE
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GrpE protein homolog 1; mitochondrial (GRPEL1); Recombinant Human GrpE protein homolog 1; mitochondrial; HMGE; Mt-GrpE#1; GRPEL1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-217aa; Full Length
Sequence
CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Sequence Length
190
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for GRPEL1 recombinant protein
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins.
Product Categories/Family for GRPEL1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.3 kDa
NCBI Official Full Name
grpE protein homolog 1, mitochondrial
NCBI Official Synonym Full Names
GrpE-like 1, mitochondrial (E. coli)
NCBI Official Symbol
GRPEL1
NCBI Official Synonym Symbols
HMGE
NCBI Protein Information
grpE protein homolog 1, mitochondrial; mt-GrpE#1; GrpE-like protein cochaperone
UniProt Protein Name
GrpE protein homolog 1, mitochondrial
Protein Family
UniProt Gene Name
GRPEL1
UniProt Synonym Gene Names
GREPEL1
UniProt Entry Name
GRPE1_HUMAN
Uniprot Description
GRPEL1: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Belongs to the GrpE family.
Protein type: Chaperone; Mitochondrial
Chromosomal Location of Human Ortholog: 4p16
Cellular Component: mitochondrion; mitochondrial matrix
Molecular Function: protein homodimerization activity; adenyl-nucleotide exchange factor activity; chaperone binding; unfolded protein binding
Biological Process: cellular protein metabolic process; protein folding; regulation of catalytic activity; protein targeting to mitochondrion
Research Articles on GRPEL1
Similar Products
Product Notes
The GRPEL1 grpel1 (Catalog #AAA1346665) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-217aa; Full Length. The amino acid sequence is listed below: CTATKQKNSG QNLEEDMGQS EQKADPPATE KTLLEEKVKL EEQLKETVEK YKRALADTEN LRQRSQKLVE EAKLYGIQAF CKDLLEVADV LEKATQCVPK EEIKDDNPHL KNLYEGLVMT EVQIQKVFTK HGLLKLNPVG AKFDPYEHEA LFHTPVEGKE PGTVALVSKV GYKLHGRTLR PALVGVVKEA. It is sometimes possible for the material contained within the vial of "GrpE protein homolog 1, mitochondrial (GRPEL1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
