anti-Human, Rat GRK6 Polyclonal Antibody | anti-GRK6 antibody

Anti-GRK6 Antibody

Cat. Num. AAA178349

• Gene Names: GRK6; GPRK6
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: GRK6; Polyclonal Antibody; Anti-GRK6 Antibody; G protein-coupled receptor kinase 6; FLJ32135; G protein coupled receptor kinase 6; G protein coupled receptor kinase GRK6; G protein-coupled receptor kinase GRK6; Gprk6; Grk6; GRK6_HUMAN; anti-GRK6 antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 560

• Applicable Applications for anti-GRK6 antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK6 (382-417aa QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- GRK6 Picoband antibody, MBS178349, Western blottingAll lanes: Anti GRK6 (MBS178349) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: K562 Whole Cell Lysate at 40ugLane 4: JURKAT Whole Cell Lysate at 40ugPredicted bind size: 66KDObserved bind size: 66KD )

Related Product Information for anti-GRK6 antibody

Description: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 6(GRK6) detection. Tested with WB in Human;Rat.

Background: G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses to morphine.

References

1. "Entrez Gene: GRK6 G protein-coupled receptor kinase 6". 2. Haribabu B, Snyderman R (Nov 1993). "Identification of additional members of human G-protein-coupled receptor kinase multigene family". Proc Natl Acad Sci U S A 90 (20): 9398-402. 3. Raehal KM, Schmid CL, Medvedev IO, Gainetdinov RR, Premont RT, Bohn LM (June 2009). "Morphine-Induced Physiological and Behavioral Responses in Mice Lacking G Protein-Coupled Receptor Kinase 6". Drug and Alcohol Dependence 104 (3): 187-96. 

NCBI and Uniprot Product Information

• NCBI GI #: 51896037
• NCBI GeneID: 2870
• NCBI Accession #: NP_001004105.1
• NCBI GenBank Nucleotide #: NM_001004105.2
• UniProt Accession #: P43250; O60541; Q13652
• Molecular Weight: 64,294 Da
• NCBI Official Full Name: G protein-coupled receptor kinase 6 isoform C
• NCBI Official Synonym Full Names: G protein-coupled receptor kinase 6
• NCBI Official Symbol: GRK6
• NCBI Official Synonym Symbols: GPRK6
• NCBI Protein Information: G protein-coupled receptor kinase 6
• UniProt Protein Name: G protein-coupled receptor kinase 6
• Protein Family: G protein-coupled receptor kinase
• UniProt Gene Name: GRK6
• UniProt Synonym Gene Names: GPRK6
• UniProt Entry Name: GRK6_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GRK6: Specifically phosphorylates the activated forms of G protein-coupled receptors. Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and signaling events leading to their desensitization. Seems to be involved in the desensitization of D2-like dopamin receptors in striatum and chemokine receptor CXCR4 which is critical for CXCL12-induced cell chemotaxis. Phosphorylates rhodopsin (RHO) (in vitro) and a non G-protein-coupled receptor: LRP6 during Wnt signaling (in vitro). Widely expressed. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Protein kinase, AGC; EC 2.7.11.16; Protein kinase, Ser/Thr (non-receptor); AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 5q35

Cellular Component: cytosol; membrane; plasma membrane

Molecular Function: ATP binding; beta-adrenergic receptor kinase activity; G-protein coupled receptor kinase activity; protein binding

Biological Process: desensitization of G-protein coupled receptor protein signaling pathway; negative regulation of anion channel activity; protein amino acid phosphorylation; regulation of G-protein coupled receptor protein signaling pathway; Wnt receptor signaling pathway