Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GRK1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit GRK1 Polyclonal Antibody | anti-GRK1 antibody

GRK1 antibody - middle region

Gene Names
GRK1; RK; RHOK; GPRK1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRK1; Polyclonal Antibody; GRK1 antibody - middle region; anti-GRK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLR
Sequence Length
563
Applicable Applications for anti-GRK1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 79%; Rat: 93%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GRK1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-GRK1 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-GRK1 antibody
This is a rabbit polyclonal antibody against GRK1. It was validated on Western Blot

Target Description: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2).
Product Categories/Family for anti-GRK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
rhodopsin kinase
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 1
NCBI Official Symbol
GRK1
NCBI Official Synonym Symbols
RK; RHOK; GPRK1
NCBI Protein Information
rhodopsin kinase
UniProt Protein Name
Rhodopsin kinase
UniProt Gene Name
GRK1
UniProt Synonym Gene Names
RHOK; RK
UniProt Entry Name
RK_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates rhodopsin and initiates its deactivation. Defects in GRK1 are known to cause Oguchi disease 2 (also known as stationary night blindness Oguchi type-2). [provided by RefSeq, Jul 2008]

Uniprot Description

GRK1: a Ser/Thr of the GRK family. Phosphorylates and inactivates photon-activated rhodopsin. LOF mutations lead to type 2 Oguchi disease, a form of night blindness. A link between RHOK and retinitis pigmentosa is now thought to be unlikely

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, AGC; EC 2.7.11.14; AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 13q34

Molecular Function: G-protein coupled receptor kinase activity; rhodopsin kinase activity; ATP binding; protein kinase activity

Biological Process: rhodopsin mediated signaling; post-embryonic retina morphogenesis in camera-type eye; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; protein amino acid autophosphorylation; photoreceptor cell morphogenesis; regulation of G-protein coupled receptor protein signaling pathway; positive regulation of phosphorylation; negative regulation of apoptosis

Disease: Oguchi Disease 2

Research Articles on GRK1

Similar Products

Product Notes

The GRK1 grk1 (Catalog #AAA3214502) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRK1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRK1 grk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKELKHRIIS EPVKYPDKFS QASKDFCEAL LEKDPEKRLG FRDETCDKLR. It is sometimes possible for the material contained within the vial of "GRK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.