Western Blot (WB)
(Host: RabbitTarget Name: GRINAAntibody Dilution: 1.0ug/mlSample Type: NCI-H226 cell lysate)
Rabbit GRINA Polyclonal Antibody | anti-GRINA antibody
GRINA antibody - middle region
Gene Names
GRINA; LFG1; HNRGW; TMBIM3; NMDARA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRINA; Polyclonal Antibody; GRINA antibody - middle region; anti-GRINA antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVREN
Sequence Length
371
Applicable Applications for anti-GRINA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GRINAAntibody Dilution: 1.0ug/mlSample Type: NCI-H226 cell lysate)
Western Blot (WB)
(Host: RabbitTarget Name: GRINAAntibody Dilution: 1.0ug/mlSample Type: NCI-H226 cell lysate)
Western Blot (WB)
(Host: RabbitTarget Name: GRINASample Type: Human NCI-H226Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Western Blot (WB)
(Host: RabbitTarget Name: GRINASample Type: Human NCI-H226Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0 ug/mlPeptide Concentration: 2.0 ug/mlLysate Quantity: 25 ug/lane)
Related Product Information for anti-GRINA antibody
This is a rabbit polyclonal antibody against GRINA. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-GRINA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
protein lifeguard 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit associated protein 1
NCBI Official Symbol
GRINA
NCBI Official Synonym Symbols
LFG1; HNRGW; TMBIM3; NMDARA1
NCBI Protein Information
protein lifeguard 1
UniProt Protein Name
Protein lifeguard 1
Protein Family
UniProt Gene Name
GRINA
UniProt Synonym Gene Names
LFG1; NMDARA1; TMBIM3
UniProt Entry Name
LFG1_HUMAN
Uniprot Description
NMDARA1: Potential apoptotic regulator. Belongs to the BI1 family. LFG subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 8q24.3
Cellular Component: Golgi apparatus; endoplasmic reticulum; integral to membrane
Biological Process: endoplasmic reticulum calcium ion homeostasis
Research Articles on GRINA
Similar Products
Product Notes
The GRINA grina (Catalog #AAA3216662) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRINA antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRINA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRINA grina for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPATNWDDKS IRQAFIRKVF LVLTLQLSVT LSTVSVFTFV AEVKGFVREN. It is sometimes possible for the material contained within the vial of "GRINA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
