Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GRB10Sample Type: HT1080 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GRB10 Polyclonal Antibody | anti-GRB10 antibody

GRB10 Antibody - N-terminal region

Gene Names
GRB10; RSS; IRBP; MEG1; GRB-IR; Grb-10
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GRB10; Polyclonal Antibody; GRB10 Antibody - N-terminal region; anti-GRB10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DDVDLEALVNDMNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPR
Sequence Length
594
Applicable Applications for anti-GRB10 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GRB10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GRB10Sample Type: HT1080 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GRB10Sample Type: HT1080 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GRB10 antibody
This is a rabbit polyclonal antibody against GRB10. It was validated on Western Blot

Target Description: The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-GRB10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
growth factor receptor-bound protein 10 isoform b
NCBI Official Synonym Full Names
growth factor receptor bound protein 10
NCBI Official Symbol
GRB10
NCBI Official Synonym Symbols
RSS; IRBP; MEG1; GRB-IR; Grb-10
NCBI Protein Information
growth factor receptor-bound protein 10
UniProt Protein Name
Growth factor receptor-bound protein 10
UniProt Gene Name
GRB10
UniProt Synonym Gene Names
GRBIR; KIAA0207
UniProt Entry Name
GRB10_HUMAN

NCBI Description

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010]

Uniprot Description

GRB10: an adaptor protein that inhibits insulin-stimulated IRS-PI (3)K-Akt signaling pathway by disrupting the association of IRS with the insulin receptor. Also binds activated PDGFR and EGFR. Preferentially localizes to the mitochondria, modulating the anti-apoptotic activity of mitochondrial Raf-1. Can translocate to the plasma membrane and lamellipodia. Three alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7p12.2

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; SH3/SH2 adaptor activity; insulin receptor binding

Biological Process: negative regulation of glucose import; negative regulation of Wnt receptor signaling pathway; insulin-like growth factor receptor signaling pathway; insulin receptor signaling pathway; negative regulation of phosphorylation; negative regulation of insulin receptor signaling pathway; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of phosphorylation; response to insulin stimulus; negative regulation of glycogen biosynthetic process

Research Articles on GRB10

Similar Products

Product Notes

The GRB10 grb10 (Catalog #AAA3219884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRB10 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRB10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRB10 grb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DDVDLEALVN DMNASLESLY SACSMQSDTV PLLQNGQHAR SQPRASGPPR. It is sometimes possible for the material contained within the vial of "GRB10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.