Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GRAP2 rabbit polyclonal antibody. Western Blot analysis of GRAP2 expression in Jurkat.)

Rabbit GRAP2 Polyclonal Antibody | anti-GRAP2 antibody

GRAP2 (GRB2 Related Adaptor Protein 2, GRAP-2, GADS, GRB2-like Protein, GRB2L, GRBLG, GrbX, Grf40 Adapter Protein, Grf-40, GRID, Growth Factor Receptor Binding Protein, GRPL, Mona, p38, SH3-SH2-SH3 Adapter Mona) (FITC)

Gene Names
GRAP2; P38; GADS; GRID; GRPL; GrbX; Mona; GRB2L; GRBLG; Grf40; GRAP-2
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRAP2; Polyclonal Antibody; GRAP2 (GRB2 Related Adaptor Protein 2; GRAP-2; GADS; GRB2-like Protein; GRB2L; GRBLG; GrbX; Grf40 Adapter Protein; Grf-40; GRID; Growth Factor Receptor Binding Protein; GRPL; Mona; p38; SH3-SH2-SH3 Adapter Mona) (FITC); anti-GRAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GRAP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
3891
Applicable Applications for anti-GRAP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GRAP2, aa1-330 (NP_004801.1).
Immunogen Sequence
MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GRAP2 rabbit polyclonal antibody. Western Blot analysis of GRAP2 expression in Jurkat.)

Western Blot (WB) (GRAP2 rabbit polyclonal antibody. Western Blot analysis of GRAP2 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 polyclonal antibody. Lane 1: GRAP2 transfected lysate (37.9kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 polyclonal antibody. Lane 1: GRAP2 transfected lysate (37.9kD). Lane 2: Non-transfected lysate)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with GRAP2 rabbit purified polyclonal 1:1200 and CSF1R mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GRAP2 and CSF1R. HeLa cells were stained with GRAP2 rabbit purified polyclonal 1:1200 and CSF1R mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GRAP2 antibody
Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.
Product Categories/Family for anti-GRAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens GRB2 related adaptor protein 2 (GRAP2), transcript variant 3, mRNA
NCBI Official Synonym Full Names
GRB2 related adaptor protein 2
NCBI Official Symbol
GRAP2
NCBI Official Synonym Symbols
P38; GADS; GRID; GRPL; GrbX; Mona; GRB2L; GRBLG; Grf40; GRAP-2
NCBI Protein Information
GRB2-related adapter protein 2
UniProt Protein Name
GRB2-related adapter protein 2
UniProt Gene Name
GRAP2
UniProt Synonym Gene Names
GADS; GRB2L; GRID; GRB2L; Grf-40
UniProt Entry Name
GRAP2_HUMAN

NCBI Description

This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Apr 2014]

Uniprot Description

GADS: Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc. Belongs to the GRB2/sem-5/DRK family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol; endosome

Molecular Function: protein binding; SH3/SH2 adaptor activity

Biological Process: positive regulation of signal transduction; cell-cell signaling; Ras protein signal transduction; T cell costimulation; innate immune response; T cell receptor signaling pathway

Research Articles on GRAP2

Similar Products

Product Notes

The GRAP2 grap2 (Catalog #AAA6380223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRAP2 (GRB2 Related Adaptor Protein 2, GRAP-2, GADS, GRB2-like Protein, GRB2L, GRBLG, GrbX, Grf40 Adapter Protein, Grf-40, GRID, Growth Factor Receptor Binding Protein, GRPL, Mona, p38, SH3-SH2-SH3 Adapter Mona) (FITC) reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GRAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRAP2 grap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.