Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Granzyme K antibody (MBS5300739) used at 1 ug/ml to detect target protein.)

Rabbit Granzyme K Polyclonal Antibody | anti-GZMK antibody

Granzyme K antibody

Gene Names
GZMK; TRYP2
Applications
Western Blot
Purity
Affinity purified
Synonyms
Granzyme K; Polyclonal Antibody; Granzyme K antibody; Polyclonal Granzyme K; Anti-Granzyme K; GZMK; TRYP2; Granzyme 3 Tryptase Ii; anti-GZMK antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GZMK antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
264
Applicable Applications for anti-GZMK antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
GZMK is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognise, bind, and lyse specific target cells.
Cross-Reactivity
Human
Immunogen
Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids LRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPF
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Granzyme K antibody (MBS5300739) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Granzyme K antibody (MBS5300739) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GZMK antibody
Rabbit polyclonal Granzyme K antibody
Product Categories/Family for anti-GZMK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26 kDa (MW of target protein)
NCBI Official Full Name
granzyme K
NCBI Official Synonym Full Names
granzyme K (granzyme 3; tryptase II)
NCBI Official Symbol
GZMK
NCBI Official Synonym Symbols
TRYP2
NCBI Protein Information
granzyme K
UniProt Protein Name
Granzyme K
Protein Family
UniProt Gene Name
GZMK
UniProt Synonym Gene Names
TRYP2; NK-Tryp-2
UniProt Entry Name
GRAK_HUMAN

NCBI Description

This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq, Jul 2008]

Uniprot Description

GZMK: this protein is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq, Jul 2008]

Protein type: EC 3.4.21.-; Secreted; Protease; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 5q11.2

Cellular Component: extracellular region

Molecular Function: serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: proteolysis

Research Articles on GZMK

Similar Products

Product Notes

The GZMK gzmk (Catalog #AAA5300739) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Granzyme K can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GZMK gzmk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Granzyme K, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.