Mouse SOCS3 Monoclonal Antibody | anti-SOCS3 antibody

SOCS3 (Suppressor of Cytokine Signaling 3, ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3) (PE)

Cat. Num. AAA6186642

• Gene Names: SOCS3; CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3
• Applications: ELISA
• Purity: Purified
• Synonyms: SOCS3; Monoclonal Antibody; SOCS3 (Suppressor of Cytokine Signaling 3; ATOD4; CIS3; Cish3; MGC71791; SOCS-3; SSI-3; SSI3) (PE); Suppressor of Cytokine Signaling 3; SSI3; anti-SOCS3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2H2
• Specificity: Recognizes SOCS3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 225

• Applicable Applications for anti-SOCS3 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: SOCS3 (AAH60858, 1aa-225aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SOCS3 is approximately 3ng/ml as a capture antibody.)

Related Product Information for anti-SOCS3 antibody

Mouse monoclonal antibody raised against a full-length recombinant SOCS3.

Product Categories/Family for anti-SOCS3 antibody

Antibodies; SOCS

NCBI and Uniprot Product Information

• NCBI GI #: 38173840
• NCBI GeneID: 9021
• NCBI Official Full Name: Suppressor of cytokine signaling 3
• NCBI Official Synonym Full Names: suppressor of cytokine signaling 3
• NCBI Official Symbol: SOCS3
• NCBI Official Synonym Symbols: CIS3; SSI3; ATOD4; Cish3; SSI-3; SOCS-3
• NCBI Protein Information: suppressor of cytokine signaling 3
• Protein Family: Suppressor of cytokine signaling

NCBI Description

This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. [provided by RefSeq, Jul 2008]