Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 MaxPab polyclonal antibody.Lane 1: GPS2 transfected lysate(36.70 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human GPS2 Polyclonal Antibody | anti-GPS2 antibody

GPS2 (G Protein pathway Suppressor 2, AMF-1, MGC104294, MGC119287, MGC119288, MGC119289) (PE)

Gene Names
GPS2; AMF-1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
GPS2; Polyclonal Antibody; GPS2 (G Protein pathway Suppressor 2; AMF-1; MGC104294; MGC119287; MGC119288; MGC119289) (PE); G Protein pathway Suppressor 2; MGC119289; anti-GPS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GPS2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-GPS2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GPS2 (NP_004480.1, 1aa-327aa) full-length human protein.
Immunogen Sequence
MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 MaxPab polyclonal antibody.Lane 1: GPS2 transfected lysate(36.70 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 MaxPab polyclonal antibody.Lane 1: GPS2 transfected lysate(36.70 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GPS2 antibody
This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS-and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq]
Product Categories/Family for anti-GPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,689 Da
NCBI Official Full Name
G protein pathway suppressor 2
NCBI Official Synonym Full Names
G protein pathway suppressor 2
NCBI Official Symbol
GPS2
NCBI Official Synonym Symbols
AMF-1
NCBI Protein Information
G protein pathway suppressor 2; GPS-2
UniProt Protein Name
G protein pathway suppressor 2
UniProt Gene Name
GPS2
UniProt Synonym Gene Names
GPS-2
UniProt Entry Name
GPS2_HUMAN

NCBI Description

This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq, Jul 2008]

Uniprot Description

GPS2: Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction.

Protein type: Inhibitor; G protein regulator, misc.; Cell cycle regulation; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: nucleoplasm; transcriptional repressor complex

Molecular Function: protein binding; transcription corepressor activity; GTPase inhibitor activity

Biological Process: negative regulation of JNK cascade; establishment and/or maintenance of chromatin architecture; JNK cascade; negative regulation of transcription from RNA polymerase II promoter; cell cycle; inactivation of MAPK activity

Research Articles on GPS2

Similar Products

Product Notes

The GPS2 gps2 (Catalog #AAA6451057) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPS2 (G Protein pathway Suppressor 2, AMF-1, MGC104294, MGC119287, MGC119288, MGC119289) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPS2 gps2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.