Rabbit anti-Human GPS2 Polyclonal Antibody | anti-GPS2 antibody

GPS2 (G Protein pathway Suppressor 2, AMF-1, MGC104294, MGC119287, MGC119288, MGC119289) (Biotin)

Cat. Num. AAA6451049

• Gene Names: GPS2; AMF-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: GPS2; Polyclonal Antibody; GPS2 (G Protein pathway Suppressor 2; AMF-1; MGC104294; MGC119287; MGC119288; MGC119289) (Biotin); G Protein pathway Suppressor 2; MGC119289; anti-GPS2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GPS2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-GPS2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: GPS2 (NP_004480.1, 1aa-327aa) full-length human protein.
• Immunogen Sequence: MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQILKLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNRPGTLMAADRAKQMFGPQVLTTRHYVGSFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQLRAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GPS2 expression in transfected 293T cell line by GPS2 MaxPab polyclonal antibody.Lane 1: GPS2 transfected lysate(36.70 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-GPS2 antibody

This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS-and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq]

Product Categories/Family for anti-GPS2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 4758472
• NCBI GeneID: 2874
• NCBI Accession #: NP_004480.1
• NCBI GenBank Nucleotide #: NM_004489.4
• UniProt Accession #: Q13227; Q6FHM8
• Molecular Weight: 36,689 Da
• NCBI Official Full Name: G protein pathway suppressor 2
• NCBI Official Synonym Full Names: G protein pathway suppressor 2
• NCBI Official Symbol: GPS2
• NCBI Official Synonym Symbols: AMF-1
• NCBI Protein Information: G protein pathway suppressor 2; GPS-2
• UniProt Protein Name: G protein pathway suppressor 2
• Protein Family: G protein pathway suppressor
• UniProt Gene Name: GPS2
• UniProt Synonym Gene Names: GPS-2
• UniProt Entry Name: GPS2_HUMAN

NCBI Description

This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. [provided by RefSeq, Jul 2008]

Uniprot Description

GPS2: Suppresses G-protein- and mitogen-activated protein kinase-mediated signal transduction.

Protein type: Inhibitor; G protein regulator, misc.; Cell cycle regulation; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: nucleoplasm; transcriptional repressor complex

Molecular Function: protein binding; transcription corepressor activity; GTPase inhibitor activity

Biological Process: negative regulation of JNK cascade; establishment and/or maintenance of chromatin architecture; JNK cascade; negative regulation of transcription from RNA polymerase II promoter; cell cycle; inactivation of MAPK activity