Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Hela cell lysate)

Rabbit GPR75 Polyclonal Antibody | anti-GPR75 antibody

GPR75 antibody - C-terminal region

Gene Names
GPR75; GPRchr2; WI31133
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR75; Polyclonal Antibody; GPR75 antibody - C-terminal region; anti-GPR75 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA
Sequence Length
540
Applicable Applications for anti-GPR75 antibody
Western Blot (WB)
Homology
Cow: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GPR75
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:100Positive Control: Hela cell lysate)
Related Product Information for anti-GPR75 antibody
This is a rabbit polyclonal antibody against GPR75. It was validated on Western Blot

Target Description: GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
Product Categories/Family for anti-GPR75 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
probable G-protein coupled receptor 75
NCBI Official Synonym Full Names
G protein-coupled receptor 75
NCBI Official Symbol
GPR75
NCBI Official Synonym Symbols
GPRchr2; WI31133
NCBI Protein Information
probable G-protein coupled receptor 75
UniProt Protein Name
Probable G-protein coupled receptor 75
UniProt Gene Name
GPR75
UniProt Entry Name
GPR75_HUMAN

NCBI Description

GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.[supplied by OMIM, Jul 2002]

Uniprot Description

GPR75: Orphan receptor. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 2p16

Cellular Component: integral to plasma membrane

Molecular Function: G-protein coupled receptor activity; C-C chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway

Similar Products

Product Notes

The GPR75 gpr75 (Catalog #AAA3201855) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR75 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR75 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR75 gpr75 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALYRNQNYNK LQHVQTRGYT KSPNQLVTPA ASRLQLVSAI NLSTAKDSKA. It is sometimes possible for the material contained within the vial of "GPR75, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.