Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GPR174 AntibodyTitration: 0.25 ug/mlPositive Control: Fetal Brain)

Rabbit GPR174 Polyclonal Antibody | anti-GPR174 antibody

GPR174 antibody - C-terminal region

Gene Names
GPR174; FKSG79; GPCR17; LYPSR3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR174; Polyclonal Antibody; GPR174 antibody - C-terminal region; anti-GPR174 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DKYPMAQDLGEKQKALKMILTCAGVFLICFAPYHFSFPLDFLVKSNEIKS
Sequence Length
333
Applicable Applications for anti-GPR174 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPR174 AntibodyTitration: 0.25 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-GPR174 AntibodyTitration: 0.25 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-GPR174 antibody
This is a rabbit polyclonal antibody against GPR174. It was validated on Western Blot

Target Description: GPR174 is a putative receptor for purines coupled to G-proteins.
Product Categories/Family for anti-GPR174 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
probable G-protein coupled receptor 174
NCBI Official Synonym Full Names
G protein-coupled receptor 174
NCBI Official Symbol
GPR174
NCBI Official Synonym Symbols
FKSG79; GPCR17; LYPSR3
NCBI Protein Information
probable G-protein coupled receptor 174
UniProt Protein Name
Probable G-protein coupled receptor 174
UniProt Gene Name
GPR174
UniProt Entry Name
GP174_HUMAN

NCBI Description

This gene encodes a protein belonging to the G protein-coupled receptor superfamily. These proteins are characterized by the presence of seven alpha-helical transmembrane domains, and they activate or interact with various endogenous or exogenous ligands, including neurotransmitters, hormones, and odorant and taste substances. This family member is classified as an orphan receptor because the cognate ligand has not been identified. [provided by RefSeq, Sep 2011]

Uniprot Description

GPR174: Putative receptor for purines coupled to G-proteins. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: Xq21.1

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on GPR174

Similar Products

Product Notes

The GPR174 gpr174 (Catalog #AAA3214719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR174 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPR174 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPR174 gpr174 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKYPMAQDLG EKQKALKMIL TCAGVFLICF APYHFSFPLD FLVKSNEIKS. It is sometimes possible for the material contained within the vial of "GPR174, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.