Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GPN1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GPN1 Polyclonal Antibody | anti-GPN1 antibody

GPN1 Antibody - middle region

Gene Names
GPN1; XAB1; MBDIN; NTPBP; RPAP4; ATPBD1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPN1; Polyclonal Antibody; GPN1 Antibody - middle region; anti-GPN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSLRVVGVSAVLGTGLDELFVQVTSAAEEYEREYRPEYERLKKSLANAES
Sequence Length
374
Applicable Applications for anti-GPN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPN1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPN1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GPN1 antibody
This gene encodes a guanosine triphosphatase enzyme. The encoded protein may play a role in DNA repair and may function in activation of transcription. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-GPN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
GPN-loop GTPase 1 isoform b
NCBI Official Synonym Full Names
GPN-loop GTPase 1
NCBI Official Symbol
GPN1
NCBI Official Synonym Symbols
XAB1; MBDIN; NTPBP; RPAP4; ATPBD1A
NCBI Protein Information
GPN-loop GTPase 1
UniProt Protein Name
GPN-loop GTPase 1
UniProt Gene Name
GPN1
UniProt Synonym Gene Names
MBDin
UniProt Entry Name
GPN1_HUMAN

NCBI Description

This gene encodes a guanosine triphosphatase enzyme. The encoded protein may play a role in DNA repair and may function in activation of transcription. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]

Uniprot Description

GPN1: Forms an interface between the RNA polymerase II enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. May be involved in nuclear localization of XPA. Belongs to the GPN-loop GTPase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: metabolic process

Research Articles on GPN1

Similar Products

Product Notes

The GPN1 gpn1 (Catalog #AAA3224132) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPN1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPN1 gpn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSLRVVGVSA VLGTGLDELF VQVTSAAEEY EREYRPEYER LKKSLANAES. It is sometimes possible for the material contained within the vial of "GPN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.