Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GPERSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit GPER Polyclonal Antibody | anti-GPER1 antibody

GPER antibody - C-terminal region

Gene Names
GPER1; mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPER; Polyclonal Antibody; GPER antibody - C-terminal region; anti-GPER1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSA
Sequence Length
375
Applicable Applications for anti-GPER1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GPERSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GPERSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GPERSample Type: Human 721_BAntibody Dilution: 1.0ug/mlGPER1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: GPERSample Type: Human 721_BAntibody Dilution: 1.0ug/mlGPER1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-GPER AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-GPER AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-GPER1 antibody
This is a rabbit polyclonal antibody against GPER. It was validated on Western Blot

Target Description: This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized.
Product Categories/Family for anti-GPER1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
G-protein coupled estrogen receptor 1
NCBI Official Synonym Full Names
G protein-coupled estrogen receptor 1
NCBI Official Symbol
GPER1
NCBI Official Synonym Symbols
mER; CEPR; GPER; DRY12; FEG-1; GPR30; LERGU; LyGPR; CMKRL2; LERGU2; GPCR-Br
NCBI Protein Information
G-protein coupled estrogen receptor 1
UniProt Protein Name
G-protein coupled estrogen receptor 1
UniProt Gene Name
GPER1
UniProt Synonym Gene Names
CEPR; CMKRL2; DRY12; GPER; GPR30; FEG-1; LYGPR; mER
UniProt Entry Name
GPER1_HUMAN

NCBI Description

This gene encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum and a member of the G-protein coupled receptor 1 family. This receptor binds estrogen and activates multiple downstream signaling pathways, leading to stimulation of adenylate cyclase and an increase in cyclic AMP levels, while also promoting intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. This receptor has been shown to play a role in diverse biological processes, including bone and nervous system development, metabolism, cognition, male fertility and uterine function. [provided by RefSeq, Aug 2017]

Uniprot Description

GPER1: Receptor for estrogen. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 7p22.3

Cellular Component: Golgi apparatus; integral to plasma membrane; early endosome; dendrite; nuclear envelope; trans-Golgi network; recycling endosome; perinuclear region of cytoplasm; cytoplasm; keratin filament; intracellular; dendritic shaft; endoplasmic reticulum membrane; cytoplasmic vesicle membrane; endoplasmic reticulum; postsynaptic density; Golgi membrane; presynaptic membrane; axon; mitochondrial membrane; presynaptic active zone; plasma membrane; nerve terminal; nucleus; cell junction

Molecular Function: G-protein coupled receptor activity; protein binding; estrogen receptor activity; chromatin binding; mineralocorticoid receptor activity; steroid binding

Biological Process: positive regulation of apoptosis; generation of action potential; positive regulation of caspase activity; nuclear fragmentation during apoptosis; negative regulation of DNA metabolic process; positive regulation of vasodilation; positive regulation of neurotransmitter secretion; negative regulation of leukocyte activation; negative regulation of cell proliferation; elevation of cytosolic calcium ion concentration; positive regulation of MAPKKK cascade; positive regulation of epidermal growth factor receptor signaling pathway; positive regulation of cAMP biosynthetic process; positive regulation of cell proliferation; inflammatory response; steroid hormone receptor signaling pathway; positive regulation of neurogenesis; cytosolic calcium ion homeostasis; negative regulation of lipid biosynthetic process; positive regulation of insulin secretion; positive regulation of inositol trisphosphate biosynthetic process; cell cycle; negative regulation of fat cell differentiation; apoptotic chromosome condensation; positive regulation of phosphoinositide 3-kinase cascade; G-protein coupled receptor protein signaling pathway; mineralocorticoid receptor signaling pathway; negative regulation of inflammatory response; positive regulation of G-protein coupled receptor protein signaling pathway; innate immune response; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; positive regulation of protein amino acid phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cell migration

Research Articles on GPER1

Similar Products

Product Notes

The GPER1 gper1 (Catalog #AAA3215548) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPER antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPER can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPER1 gper1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFLGETFRDK LRLYIEQKTN LPALNRFCHA ALKAVIPDST EQSDVRFSSA. It is sometimes possible for the material contained within the vial of "GPER, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.