Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GOLPH3Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GOLPH3 Polyclonal Antibody | anti-GOLPH3 antibody

GOLPH3 Antibody - N-terminal region

Gene Names
GOLPH3; GOPP1; GPP34; MIDAS; Vps74
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GOLPH3; Polyclonal Antibody; GOLPH3 Antibody - N-terminal region; anti-GOLPH3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCIS
Sequence Length
298
Applicable Applications for anti-GOLPH3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GOLPH3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GOLPH3Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GOLPH3Sample Tissue: Human Large Intestine Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GOLPH3 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.
Product Categories/Family for anti-GOLPH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
Golgi phosphoprotein 3
NCBI Official Synonym Full Names
golgi phosphoprotein 3
NCBI Official Symbol
GOLPH3
NCBI Official Synonym Symbols
GOPP1; GPP34; MIDAS; Vps74
NCBI Protein Information
Golgi phosphoprotein 3
UniProt Protein Name
Golgi phosphoprotein 3
Protein Family
UniProt Gene Name
GOLPH3
UniProt Synonym Gene Names
GPP34; MIDAS
UniProt Entry Name
GOLP3_HUMAN

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

GOLPH3: Mediates the cis and medial Golgi localization of mannosyltransferases through direct binding of their cytosolic domains. Involved in modulation of mTOR signaling. Involved in the regulation of mitochondrial lipids, leading to increase of mitochondrial mass. Potential oncogene. Belongs to the GOLPH3/VPS74 family.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 5p13.3

Cellular Component: nucleoplasm; Golgi apparatus; Golgi cisterna; mitochondrion; plasma membrane; mitochondrial intermembrane space; trans-Golgi network; cytosol; endosome

Molecular Function: protein binding; enzyme binding

Biological Process: lamellipodium biogenesis; cell proliferation; cell migration; positive regulation of protein secretion; glycoprotein biosynthetic process; Golgi to plasma membrane protein transport; protein secretion; gene expression; Golgi vesicle budding; leukocyte tethering or rolling; protein retention in Golgi; Golgi organization and biogenesis; positive regulation of TOR signaling pathway

Research Articles on GOLPH3

Similar Products

Product Notes

The GOLPH3 golph3 (Catalog #AAA3221714) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLPH3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOLPH3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOLPH3 golph3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDDAQSRRDE QDDDDKGDSK ETRLTLMEEV LLLGLKDREG YTSFWNDCIS. It is sometimes possible for the material contained within the vial of "GOLPH3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.