Rabbit anti-Human SUMO1 Monoclonal Antibody | anti-SUMO1 antibody

[KO Validated] SUMO1 Rabbit mAb

• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, ELISA
• Purity: Affinity purification
• Synonyms: SUMO1; Monoclonal Antibody; [KO Validated] SUMO1 Rabbit mAb; DAP1; GMP1; PIC1; SMT3; UBL1; OFC10; SENP2; SMT3C; SMT3H3; O1; anti-SUMO1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

• Applicable Applications for anti-SUMO1 antibody: Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunofluorescence (IF), Immunocytochemistry (ICC), ELISA (EIA)
• Application Notes: WB: 1:1000-1:2000; IHC-P: 1:2000-1:10000; IF/ICC: 1:200-1:400; ELISA: Recommended starting concentration is 1ug/mL.; Please optimize the concentration based on your specific assay requirements.
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-101 of human Sumo 1 (P63165).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using [KO Validated] SUMO1 Rabbit mAb (AAA28492,dilution 1:100)(Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and SUMO1 knockout (KO) 293T cells, using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] SUMO1 Rabbit mAb (AAA28492) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Related Product Information for anti-SUMO1 antibody

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last four amino acids of the carboxy-terminus have been cleaved off. Several pseudogenes have been reported for this gene. Alternate transcriptional splice variants encoding different isoforms have been characterized.

Product Categories/Family for anti-SUMO1 antibody

Epigenetics Nuclear Signaling; RNA Binding; Cell Biology Developmental Biology; Autophagy; Ubiquitin; Endocrine Metabolism; Mitochondrial metabolism; Immunology Inflammation; Jak-Stat-IL-6 Receptor Signaling Pathway; NF-kB Signaling Pathway; Cardiovascula

NCBI and Uniprot Product Information

• NCBI GI #: 54792065
• NCBI GeneID: 7341
• NCBI Accession #: NP_001005781.1
• NCBI GenBank Nucleotide #: NM_001005781.1
• UniProt Accession #: P63165; P55856; Q6FGG0; Q6NZ62; Q93068; B2R4I5
• Molecular Weight: Calculated MW: 12kDa; Observed MW: 17kDa/80kDa
• UniProt Protein Name: Small ubiquitin-related modifier 1
• UniProt Gene Name: SUMO1
• UniProt Synonym Gene Names: SMT3C; SMT3H3; UBL1; SUMO-1; GMP1; Smt3C
• UniProt Entry Name: SUMO1_HUMAN