Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody. Lane 1: GNG7 transfected lysate (7.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GNG7 Polyclonal Antibody | anti-GNG7 antibody

GNG7 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-7, GNGT7, FLJ00058) (AP)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNG7; Polyclonal Antibody; GNG7 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-7; GNGT7; FLJ00058) (AP); anti-GNG7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GNG7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GNG7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GNG7, aa1-68 (NP_443079.1).
Immunogen Sequence
MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody. Lane 1: GNG7 transfected lysate (7.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNG7 expression in transfected 293T cell line by GNG7 polyclonal antibody. Lane 1: GNG7 transfected lysate (7.5kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with GNG7 rabbit purified polyclonal 1:1200 and GNB5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between GNG7 and GNB5. HeLa cells were stained with GNG7 rabbit purified polyclonal 1:1200 and GNB5 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-GNG7 antibody
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum.
Product Categories/Family for anti-GNG7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,522 Da
NCBI Official Full Name
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
NCBI Official Synonym Full Names
guanine nucleotide binding protein (G protein), gamma 7
NCBI Official Symbol
GNG7
NCBI Protein Information
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
UniProt Protein Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
UniProt Gene Name
GNG7
UniProt Synonym Gene Names
GNGT7
UniProt Entry Name
GBG7_HUMAN

Uniprot Description

G-gamma 7: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum. Belongs to the G protein gamma family.

Protein type: G protein, heterotrimeric gamma; G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: plasma membrane; heterotrimeric G-protein complex

Molecular Function: signal transducer activity

Biological Process: regulation of adenylate cyclase activity; G-protein coupled receptor protein signaling pathway; synaptic transmission; behavioral fear response; receptor guanylyl cyclase signaling pathway; energy reserve metabolic process; locomotory behavior; regulation of G-protein coupled receptor protein signaling pathway

Research Articles on GNG7

Similar Products

Product Notes

The GNG7 gng7 (Catalog #AAA6380055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNG7 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-7, GNGT7, FLJ00058) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNG7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNG7 gng7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNG7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.