Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: GNA14Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit GNA11 Polyclonal Antibody | anti-GNA11 antibody

GNA11 antibody - C-terminal region

Gene Names
GNA11; FBH; FBH2; FHH2; HHC2; GNA-11; HYPOC2
Reactivity
Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNA11; Polyclonal Antibody; GNA11 antibody - C-terminal region; anti-GNA11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVES
Sequence Length
359
Applicable Applications for anti-GNA11 antibody
Western Blot (WB)
Homology
Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: GNA14Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: GNA14Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: 293TAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: HelaAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GNA11 is expressed in HeLa)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNA11Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNA11Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-GNA11 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-GNA11 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-GNA11 antibody
This is a rabbit polyclonal antibody against GNA11. It was validated on Western Blot

Target Description: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.
Product Categories/Family for anti-GNA11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
guanine nucleotide-binding protein subunit alpha-11
NCBI Official Synonym Full Names
G protein subunit alpha 11
NCBI Official Symbol
GNA11
NCBI Official Synonym Symbols
FBH; FBH2; FHH2; HHC2; GNA-11; HYPOC2
NCBI Protein Information
guanine nucleotide-binding protein subunit alpha-11
UniProt Protein Name
Guanine nucleotide-binding protein subunit alpha-11
UniProt Gene Name
gna11
UniProt Synonym Gene Names
G alpha-11; G-protein subunit alpha-11

NCBI Description

The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. [provided by RefSeq, Dec 2013]

Uniprot Description

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.

Research Articles on GNA11

Similar Products

Product Notes

The GNA11 gna11 (Catalog #AAA3216607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNA11 antibody - C-terminal region reacts with Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNA11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNA11 gna11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFDLENIIFR MVDVGGQRSE RRKWIHCFEN VTSIMFLVAL SEYDQVLVES. It is sometimes possible for the material contained within the vial of "GNA11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.