Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GMPR2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit GMPR2 Polyclonal Antibody | anti-GMPR2 antibody

GMPR2 antibody - C-terminal region

Gene Names
GMPR2; GMPR 2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GMPR2; Polyclonal Antibody; GMPR2 antibody - C-terminal region; anti-GMPR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGV
Sequence Length
185
Applicable Applications for anti-GMPR2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GMPR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GMPR2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-GMPR2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-GMPR2 antibody
This is a rabbit polyclonal antibody against GMPR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GMPR2 catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. It plays a role in modulating cellular differentiation.
Product Categories/Family for anti-GMPR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
guanosine monophosphate reductase 2, isoform CRA_e
NCBI Official Synonym Full Names
guanosine monophosphate reductase 2
NCBI Official Symbol
GMPR2
NCBI Official Synonym Symbols
GMPR 2
NCBI Protein Information
GMP reductase 2
UniProt Protein Name
GMP reductase 2
Protein Family
UniProt Gene Name
GMPR2
UniProt Synonym Gene Names
Guanosine monophosphate reductase 2
UniProt Entry Name
GMPR2_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]

Uniprot Description

GMPR2: Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation. Belongs to the IMPDH/GMPR family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.7.1.7; Nucleotide Metabolism - purine; Oxidoreductase

Chromosomal Location of Human Ortholog: 14q12

Cellular Component: cytosol

Molecular Function: GMP reductase activity; metal ion binding

Biological Process: nucleobase, nucleoside and nucleotide metabolic process; purine salvage; GMP metabolic process; purine base metabolic process

Research Articles on GMPR2

Similar Products

Product Notes

The GMPR2 gmpr2 (Catalog #AAA3208985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMPR2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GMPR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GMPR2 gmpr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAGADFVMLG GMLAGHSESG GELIERDGKK YKLFYGMSSE MAMKKYAGGV. It is sometimes possible for the material contained within the vial of "GMPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.