Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GMPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit GMPR Polyclonal Antibody | anti-GMPR antibody

GMPR antibody - C-terminal region

Gene Names
FFAR4; GT01; PGR4; BMIQ10; GPR120; GPR129; O3FAR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GMPR; Polyclonal Antibody; GMPR antibody - C-terminal region; anti-GMPR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAA
Sequence Length
345
Applicable Applications for anti-GMPR antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GMPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-GMPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-GMPR antibody
This is a rabbit polyclonal antibody against GMPR. It was validated on Western Blot

Target Description: This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of GMP to IMP. The protein also functions in the re-utilization of free intracellular bases and purine nucleosides.
Product Categories/Family for anti-GMPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
free fatty acid receptor 4 isoform GPR120-L
NCBI Official Synonym Full Names
free fatty acid receptor 4
NCBI Official Symbol
FFAR4
NCBI Official Synonym Symbols
GT01; PGR4; BMIQ10; GPR120; GPR129; O3FAR1
NCBI Protein Information
free fatty acid receptor 4
UniProt Protein Name
Free fatty acid receptor 4
Protein Family
UniProt Gene Name
FFAR4
UniProt Synonym Gene Names
GPR120; GPR129; O3FAR1; PGR4
UniProt Entry Name
FFAR4_HUMAN

NCBI Description

This gene encodes a G protein-coupled receptor (GPR) which belongs to the rhodopsin family of GPRs. The encoded protein functions as a receptor for free fatty acids, including omega-3, and participates in suppressing anti-inflammatory responses and insulin sensitizing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

GPR120: Receptor for medium and long-chain free fatty acid (FAA). Signals via a G(q)/G(11)-coupled pathway. Acts as a receptor for omega-3 fatty acids and mediates robust anti- inflammatory effects particularly in macrophages and fat cells. The anti-inflammatory effects involve inhibition of TAK1 through a beta-arrestin 2 (ARRB2)/TAB1 dependent effect but independent of G(q)/G(11)-coupled pathway. Mediates potent insulin sensitizing and antidiabetic effects by repressing macrophage-induced tissue inflammation. May mediate the taste of fatty acids. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Lipid-binding; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: endocytic vesicle; integral to plasma membrane; plasma membrane

Molecular Function: peptide binding; fatty acid binding; taste receptor activity

Biological Process: hormone secretion; G-protein coupled receptor protein signaling pathway; negative regulation of inflammatory response; negative regulation of cytokine secretion; detection of chemical stimulus involved in sensory perception of taste; negative regulation of apoptosis; cellular response to hormone stimulus

Disease: Body Mass Index Quantitative Trait Locus 10

Research Articles on GMPR

Similar Products

Product Notes

The GMPR ffar4 (Catalog #AAA3215666) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMPR antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GMPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GMPR ffar4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAMNKHAGGV AEYRASEGKT VEVPYKGDVE NTILDILGGL RSTCTYVGAA. It is sometimes possible for the material contained within the vial of "GMPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.