Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Glycoprotein VI antibody (MBS5302841) used at 1 ug/ml to detect target protein.)

Rabbit Glycoprotein VI Polyclonal Antibody | anti-GP6 antibody

Glycoprotein VI antibody

Gene Names
GP6; GPIV; GPVI; BDPLT11
Applications
Western Blot
Purity
Affinity purified
Synonyms
Glycoprotein VI; Polyclonal Antibody; Glycoprotein VI antibody; Polyclonal Glycoprotein VI; Anti-Glycoprotein VI; MGC138168; GPIV; GP6; GPVI; anti-GP6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GP6 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
11
Applicable Applications for anti-GP6 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Glycoprotein VI (GP6) is a 58 kDa platelet membrane glycoprotein that plays a crucial role in the collagen-induced activation and aggregation of platelets. Collagen receptor involved in collagen-induced platelet adhesion and activation. GP6 plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely Fyn/Lyn), the adapter protein LAT and leads to the activation of phospholipase C gamma2.
Cross-Reactivity
Human
Immunogen
Glycoprotein VI antibody was raised using a synthetic peptide corresponding to a region with amino acids PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Glycoprotein VI antibody (MBS5302841) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Glycoprotein VI antibody (MBS5302841) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GP6 antibody
Rabbit polyclonal Glycoprotein VI antibody
Product Categories/Family for anti-GP6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
glycoprotein VI, partial
NCBI Official Synonym Full Names
glycoprotein VI (platelet)
NCBI Official Symbol
GP6
NCBI Official Synonym Symbols
GPIV; GPVI; BDPLT11
NCBI Protein Information
platelet glycoprotein VI
UniProt Protein Name
Platelet glycoprotein VI
Protein Family
UniProt Gene Name
GP6
UniProt Synonym Gene Names
GPVI
UniProt Entry Name
GPVI_HUMAN

NCBI Description

This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

GPVI: Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma- chain, the Src kinases (likely Fyn/Lyn), the adapter protein LAT and leads to the activation of phospholipase C gamma2. Defects in GP6 are the cause of bleeding disorder platelet-type 11 (BDPLT11). BDPLT11 is a mild to moderate bleeding disorder caused by defective platelet activation and aggregation in response to collagen. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: cell surface; integral to plasma membrane; plasma membrane

Molecular Function: collagen binding; protein binding; transmembrane receptor activity; receptor activity

Biological Process: platelet activation; blood coagulation; enzyme linked receptor protein signaling pathway; leukocyte migration

Disease: Bleeding Disorder, Platelet-type, 11

Research Articles on GP6

Similar Products

Product Notes

The GP6 gp6 (Catalog #AAA5302841) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Glycoprotein VI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the GP6 gp6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Glycoprotein VI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.