Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Glycogen Synthase 2 antibody (MBS839732) used at 1 ug/ml to detect target protein.)

Rabbit Glycogen Synthase 2 Polyclonal Antibody | anti-glgA2 antibody

Glycogen Synthase 2 antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Glycogen Synthase 2; Polyclonal Antibody; Glycogen Synthase 2 antibody; Polyclonal Glycogen Synthase 2; Anti-Glycogen Synthase 2; Glycogen Synthase -2; GYS2; anti-glgA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GYS2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
513
Applicable Applications for anti-glgA2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
GYS2 transfers the glycosyl residue from UDP-Glc to the non-reducing end of alpha-1,4-glucan.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Glycogen Synthase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Glycogen Synthase 2 antibody (MBS839732) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Glycogen Synthase 2 antibody (MBS839732) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-glgA2 antibody
Rabbit polyclonal Glycogen Synthase 2 antibody
Product Categories/Family for anti-glgA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
81 kDa (MW of target protein)
NCBI Official Full Name
Glycogen synthase 2
UniProt Protein Name
Glycogen synthase 2
Protein Family
UniProt Gene Name
glgA2
UniProt Entry Name
GLGA2_SYNJB

Uniprot Description

Synthesizes alpha-1,4-glucan chains using ADP-glucose.

Similar Products

Product Notes

The Glycogen Synthase 2 glga2 (Catalog #AAA839732) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Glycogen Synthase 2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Glycogen Synthase 2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Glycogen Synthase 2 glga2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Glycogen Synthase 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.