Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GLO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit GLO1 Polyclonal Antibody | anti-GLO1 antibody

GLO1 antibody - N-terminal region

Gene Names
GLO1; GLYI; GLOD1; HEL-S-74
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GLO1; Polyclonal Antibody; GLO1 antibody - N-terminal region; anti-GLO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE
Sequence Length
184
Applicable Applications for anti-GLO1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 86%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GLO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-GLO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-GLO1 antibody
This is a rabbit polyclonal antibody against GLO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
Product Categories/Family for anti-GLO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
lactoylglutathione lyase
NCBI Official Synonym Full Names
glyoxalase I
NCBI Official Symbol
GLO1
NCBI Official Synonym Symbols
GLYI; GLOD1; HEL-S-74
NCBI Protein Information
lactoylglutathione lyase
UniProt Protein Name
Lactoylglutathione lyase
UniProt Gene Name
GLO1
UniProt Synonym Gene Names
Glx I
UniProt Entry Name
LGUL_HUMAN

NCBI Description

The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere. [provided by RefSeq, Jul 2008]

Uniprot Description

GLO1: Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF- kappa-B. Belongs to the glyoxalase I family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - pyruvate; EC 4.4.1.5; Lyase

Chromosomal Location of Human Ortholog: 6p21.3-p21.1

Cellular Component: cytoplasm

Molecular Function: zinc ion binding; lactoylglutathione lyase activity

Biological Process: regulation of transcription from RNA polymerase II promoter; glutathione metabolic process; carbohydrate metabolic process; osteoclast differentiation; methylglyoxal metabolic process; negative regulation of apoptosis

Disease: Autism

Research Articles on GLO1

Similar Products

Product Notes

The GLO1 glo1 (Catalog #AAA3211872) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLO1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GLO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GLO1 glo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMLRVKDPKK SLDFYTRVLG MTLIQKCDFP IMKFSLYFLA YEDKNDIPKE. It is sometimes possible for the material contained within the vial of "GLO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.