Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-GLCCI1 Polyclonal Antibody)

Rabbit anti-Human, Mouse GLCCI1 Polyclonal Antibody | anti-GLCCI1 antibody

GLCCI1 Polyclonal Antibody

Gene Names
GLCCI1; GCTR; GIG18; TSSN1; FAM117C
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GLCCI1; Polyclonal Antibody; GLCCI1 Polyclonal Antibody; FAM117C; GCTR; GIG18; TSSN1; glucocorticoid induced 1; anti-GLCCI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.79 mg/ml (varies by lot)
Sequence Length
547
Applicable Applications for anti-GLCCI1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-230 of human GLCCI1 (NP_612435.1).
Immunogen Sequence
QAPRAKGRPRRSPESHRRSSSPERRSPGSPVCRADKAKSQQVRTSSTIRRTSSLDTITGPYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADQL
Positive Samples
HepG2, Mouse Thymus, Mouse Brain, Mouse Heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-GLCCI1 Polyclonal Antibody)

Western Blot (WB) (Western blot-GLCCI1 Polyclonal Antibody)
Related Product Information for anti-GLCCI1 antibody
This gene encodes a protein of unknown function. Expression of this gene is induced by glucocorticoids and may be an early marker for glucocorticoid-induced apoptosis. Single nucleotide polymorphisms in this gene are associated with a decreased response to inhaled glucocorticoids in asthmatic patients.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 58kDa
Observed: 58kDa
NCBI Official Full Name
glucocorticoid-induced transcript 1 protein
NCBI Official Synonym Full Names
glucocorticoid induced 1
NCBI Official Symbol
GLCCI1
NCBI Official Synonym Symbols
GCTR; GIG18; TSSN1; FAM117C
NCBI Protein Information
glucocorticoid-induced transcript 1 protein
UniProt Protein Name
Glucocorticoid-induced transcript 1 protein
UniProt Gene Name
GLCCI1
UniProt Entry Name
GLCI1_HUMAN

NCBI Description

This gene encodes a protein of unknown function. Expression of this gene is induced by glucocorticoids and may be an early marker for glucocorticoid-induced apoptosis. Single nucleotide polymorphisms in this gene are associated with a decreased response to inhaled glucocorticoids in asthmatic patients. [provided by RefSeq, Feb 2012]

Uniprot Description

GLCCI1:

Chromosomal Location of Human Ortholog: 7p21.3

Cellular Component: cytoplasm

Disease: Glucocorticoid Therapy, Response To

Research Articles on GLCCI1

Similar Products

Product Notes

The GLCCI1 glcci1 (Catalog #AAA9140626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLCCI1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GLCCI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the GLCCI1 glcci1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLCCI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.