Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Gjb3 Antibody Titration: 0.125ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)

Rabbit Gjb3 Polyclonal Antibody | anti-GJB3 antibody

Gjb3 antibody - N-terminal region

Gene Names
Gjb3; Cx31; Cnx31; Gjb-3; D4Wsu144e
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Gjb3; Polyclonal Antibody; Gjb3 antibody - N-terminal region; anti-GJB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDWKKLQDLLSGVNQYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKD
Sequence Length
270
Applicable Applications for anti-GJB3 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 83%; Horse: 83%; Human: 83%; Mouse: 100%; Pig: 83%; Rabbit: 79%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Gjb3 Antibody Titration: 0.125ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-Gjb3 Antibody Titration: 0.125ug/mlELISA Titer: 1:1562500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-GJB3 antibody
This is a rabbit polyclonal antibody against Gjb3. It was validated on Western Blot

Target Description: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Product Categories/Family for anti-GJB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
gap junction beta-3 protein
NCBI Official Synonym Full Names
gap junction protein, beta 3
NCBI Official Symbol
Gjb3
NCBI Official Synonym Symbols
Cx31; Cnx31; Gjb-3; D4Wsu144e
NCBI Protein Information
gap junction beta-3 protein
UniProt Protein Name
Gap junction beta-3 protein
UniProt Gene Name
Gjb3
UniProt Synonym Gene Names
Cxn-31; Cx31
UniProt Entry Name
CXB3_MOUSE

Research Articles on GJB3

Similar Products

Product Notes

The GJB3 gjb3 (Catalog #AAA3206570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gjb3 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Gjb3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GJB3 gjb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDWKKLQDLL SGVNQYSTAF GRIWLSVVFV FRVLVYVVAA ERVWGDEQKD. It is sometimes possible for the material contained within the vial of "Gjb3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.