Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- GJA3 Picoband antibody, MBS178129, Western blottingAll lanes: Anti GJA3 (MBS178129) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 55KD )

GJA3 Polyclonal Antibody | anti-GJA3 antibody

Anti-GJA3 Antibody

Gene Names
GJA3; CX46; CZP3; CTRCT14
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
GJA3; Polyclonal Antibody; Anti-GJA3 Antibody; Gap junction alpha-3 protein; CAE3; Connexin 46; Connexin-46; Connexin46; Cx46; CXA3_HUMAN; CZP3; Gap junction alpha 3 protein; Gap junction protein; alpha 3; 46kD (connexin 46); 46kDa (connexin 46); 46kDa; Gja3; gap junction protein; anti-GJA3 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
435
Applicable Applications for anti-GJA3 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GJA3 (89-118aa TLIYLGHVLHIVRMEEKKKEREEEEQLKRE), different from the related mouse and rat sequences by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- GJA3 Picoband antibody, MBS178129, Western blottingAll lanes: Anti GJA3 (MBS178129) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 55KD )

Western Blot (WB) (Anti- GJA3 Picoband antibody, MBS178129, Western blottingAll lanes: Anti GJA3 (MBS178129) at 0.5ug/mlLane 1: Rat Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 47KDObserved bind size: 55KD )
Related Product Information for anti-GJA3 antibody
Description: Rabbit IgG polyclonal antibody for Gap junction alpha-3 protein(GJA3) detection. Tested with WB in Human;Mouse;Rat.

Background: Gap junction alpha-3 protein, also known as Connexin-46, is a protein that in humans is encoded by the GJA3 gene. This gene is mapped to 13q12.11. The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3).
References
1. Burdon, K. P., Wirth, M. G., Mackey, D. A., Russell-Eggitt, I. M., Craig, J. E., Elder, J. E., Dickinson, J. L., Sale, M. M. A novel mutation in the connexin 46 gene causes autosomal dominant congenital cataract with incomplete penetrance. J. Med. Genet. 41: e106, 2004. Note: Electronic Article. Errata: J. Med. Genet. 42: 288 only, 2004; J. Med. Genet. 45: 256 only, 2008. 2. Chang, B., Wang, X., Hawes, N. L., Ojakian, R., Davisson, M. T., Lo, W.-K., Gong, X. A Gja8 (Cx50) point mutation causes an alteration of alpha-3 connexin (Cx46) in semi-dominant cataracts of Lop10 mice. Hum. Molec. Genet. 11: 507-513, 2002. 3. White, T. W. Unique and redundant connexin contributions to lens development.Science 295: 319-320, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,410 Da
NCBI Official Full Name
gap junction alpha-3 protein
NCBI Official Synonym Full Names
gap junction protein alpha 3
NCBI Official Symbol
GJA3
NCBI Official Synonym Symbols
CX46; CZP3; CTRCT14
NCBI Protein Information
gap junction alpha-3 protein
UniProt Protein Name
Gap junction alpha-3 protein
UniProt Gene Name
GJA3
UniProt Synonym Gene Names
Cx46
UniProt Entry Name
CXA3_HUMAN

NCBI Description

The protein encoded by this gene is a connexin and is a component of lens fiber gap junctions. Defects in this gene are a cause of zonular pulverulent cataract type 3 (CZP3). [provided by RefSeq, Jan 2010]

Uniprot Description

GJA3: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of cataract zonular pulverulent cataract type 3 (CZP3). A form of zonular cataract. Zonular or lamellar cataracts are opacities, broad or narrow, usually consisting of powdery white dots affecting only certain layers or zones between the cortex and nucleus of an otherwise clear lens. The opacity may be so dense as to render the entire central region of the lens completely opaque, or so translucent that vision is hardly if at all impeded. Zonular cataracts generally do not involve the embryonic nucleus, though sometimes they involve the fetal nucleus. Usually sharply separated from a clear cortex outside them, they may have projections from their outer edges known as riders or spokes. Defects in GJA3 are a cause of cataract autosomal dominant (ADC). Cataract is an opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. Belongs to the connexin family. Alpha-type (group II) subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q12.11

Cellular Component: connexon complex; integral to membrane; lipid raft

Molecular Function: gap junction channel activity; identical protein binding

Biological Process: cell-cell signaling; response to hydrogen peroxide; response to pH; transmembrane transport; transport; visual perception

Disease: Cataract 14, Multiple Types

Research Articles on GJA3

Similar Products

Product Notes

The GJA3 gja3 (Catalog #AAA178129) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-GJA3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GJA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the GJA3 gja3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GJA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.