Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit GFI1B Polyclonal Antibody | anti-GFI1B antibody

GFI1B antibody - N-terminal region

Gene Names
GFI1B; BDPLT17; ZNF163B
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GFI1B; Polyclonal Antibody; GFI1B antibody - N-terminal region; anti-GFI1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Sequence Length
330
Applicable Applications for anti-GFI1B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 83%; Dog: 100%; Goat: 83%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 93%; Rat: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GFI1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubule and renal corpuscleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-GFI1B AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubule and renal corpuscleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-GFI1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-GFI1B antibody
This is a rabbit polyclonal antibody against GFI1B. It was validated on Western Blot and immunohistochemistry

Target Description: GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
zinc finger protein Gfi-1b isoform 1
NCBI Official Synonym Full Names
growth factor independent 1B transcriptional repressor
NCBI Official Symbol
GFI1B
NCBI Official Synonym Symbols
BDPLT17; ZNF163B
NCBI Protein Information
zinc finger protein Gfi-1b
UniProt Protein Name
Zinc finger protein Gfi-1b
Protein Family
UniProt Gene Name
GFI1B
UniProt Entry Name
GFI1B_HUMAN

NCBI Description

This gene encodes a zinc-finger containing transcriptional regulator that is primarily expressed in cells of hematopoietic lineage. The encoded protein complexes with numerous other transcriptional regulatory proteins including GATA-1, runt-related transcription factor 1 and histone deacetylases to control expression of genes involved in the development and maturation of erythrocytes and megakaryocytes. Mutations in this gene are the cause of the autosomal dominant platelet disorder, platelet-type bleeding disorder-17. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]

Uniprot Description

Function: Essential proto-oncogenic transcriptional regulator necessary for development and differentiation of erythroid and megakaryocytic lineages. Component of a RCOR-GFI-KDM1A-HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation. Transcriptional repressor or activator depending on both promoter and cell type context; represses promoter activity of SOCS1 and SOCS3 and thus, may regulate cytokine signaling pathways. Cooperates with GATA1 to repress target gene transcription, such as the apoptosis regulator BCL2L1; GFI1B silencing in leukemic cell lines markedly increase apoptosis rate. Inhibits down-regulation of MYC and MYB as well as the cyclin-dependent kinase inhibitor CDKN1A/P21WAF1 in IL6-treated myelomonocytic cells. Represses expression of GATA3 in T-cell lymphomas and inhibits GATA1-mediated transcription; as GATA1 also mediates erythroid GFI1B transcription, both GATA1 and GFI1B participate in a feedback regulatory pathway controlling the expression of GFI1B gene in erythroid cells. Suppresses GATA1-mediated stimulation of GFI1B promoter through protein interaction. Binds to gamma-satellite DNA and to its own promoter, auto-repressing its own expression. Alters histone methylation by recruiting histone methyltransferase to target genes promoters. Plays a role in heterochromatin formation. Ref.7 Ref.9 Ref.10 Ref.11 Ref.13 Ref.14 Ref.15 Ref.16

Subunit structure: Component of a RCOR-GFI-KDM1A-HDAC complex. Interacts directly with RCOR1, KDM1A and HDAC2

By similarity. Forms a complex with GATA1. Interacts with histone methyltransferases EHMT2 and SUV39H1. Interacts with ARIH2 (via RING-type 2). Interacts with RUNX1T1. Ref.8 Ref.9 Ref.10 Ref.12 Ref.15

Subcellular location: Nucleus Ref.10.

Tissue specificity: Expressed in bone marrow and fetal liver, but also detectable in fetal spleen, fetal thymus, and testes. Detected in hematopoietic stem cells, erythroblasts, and megakaryocytes. Overexpressed in bone marrow of patients with erythroleukemia and megakaryocytic leukemia as well as in their corresponding leukemic cell lines, and markedly repressed in severe aplastic anemia (SAA). Ref.1 Ref.7 Ref.14

Induction: By GATA1 which binds to GFI1B promoter in cooperation with the transcription factor NFYA. Target gene of transcription factor E2-alpha/TCF3 that promotes growth arrest and apoptosis in lymphomas. Ref.2

Domain: The zinc finger domains are essential for erythroid expansion and acts as an activation domain whereas non finger domain serves as repression domain

By similarity.The SNAG domain of GFIs is required for nuclear location and for interaction with some corepressors

By similarity.

Post-translational modification: Methylation at Lys-8 in the SNAG domain seems required for the recruitment of the corepressor complex. Ref.16

Sequence similarities: Contains 6 C2H2-type zinc fingers.

Research Articles on GFI1B

Similar Products

Product Notes

The GFI1B gfi1b (Catalog #AAA3200165) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GFI1B antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GFI1B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GFI1B gfi1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPRSFLVKSK MAHTYHQPRV QEDEPLWPPA LTPVPRDQAP SNSPVLSTLF. It is sometimes possible for the material contained within the vial of "GFI1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.