Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GET4Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit GET4 Polyclonal Antibody | anti-GET4 antibody

GET4 Antibody - C-terminal region

Gene Names
GET4; CEE; TRC35; CGI-20; C7orf20
Reactivity
Guinea Pig, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GET4; Polyclonal Antibody; GET4 Antibody - C-terminal region; anti-GET4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRIGQLFFGVPPKQTSSYGGLLGNLLTSLMGSSEQEDGEESPSDGSPIEL
Sequence Length
274
Applicable Applications for anti-GET4 antibody
Western Blot (WB)
Homology
Guinea Pig: 77%; Human: 100%; Mouse: 77%; Rat: 77%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GET4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GET4Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GET4Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GET4 antibody
This is a rabbit polyclonal antibody against GET4. It was validated on Western Blot

Target Description: GET4 is a component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.
Product Categories/Family for anti-GET4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
Golgi to ER traffic protein 4 homolog
NCBI Official Synonym Full Names
golgi to ER traffic protein 4
NCBI Official Symbol
GET4
NCBI Official Synonym Symbols
CEE; TRC35; CGI-20; C7orf20
NCBI Protein Information
Golgi to ER traffic protein 4 homolog
UniProt Protein Name
Golgi to ER traffic protein 4 homolog
UniProt Gene Name
GET4
UniProt Synonym Gene Names
C7orf20; CEE; TRC35; TRC35
UniProt Entry Name
GET4_HUMAN

Uniprot Description

GET4: Component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting. Belongs to the GET4 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7p22.3

Cellular Component: cytosol

Biological Process: transport

Research Articles on GET4

Similar Products

Product Notes

The GET4 get4 (Catalog #AAA3215121) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GET4 Antibody - C-terminal region reacts with Guinea Pig, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GET4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GET4 get4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRIGQLFFGV PPKQTSSYGG LLGNLLTSLM GSSEQEDGEE SPSDGSPIEL. It is sometimes possible for the material contained within the vial of "GET4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.