Western Blot (WB)
(GCNT2 rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.)
Rabbit anti-Human GCNT2 Polyclonal Antibody | anti-GCNT2 antibody
GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Isoform A, N-acetylglucosaminyltransferase, I-branching Enzyme, IGNT, GCNT5, II, NACGT1)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GCNT2; Polyclonal Antibody; GCNT2 (N-acetyllactosaminide beta-1; 6-N-acetylglucosaminyl-transferase; Isoform A; N-acetylglucosaminyltransferase; I-branching Enzyme; IGNT; GCNT5; II; NACGT1); Anti -GCNT2 (N-acetyllactosaminide beta-1; anti-GCNT2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GCNT2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Applicable Applications for anti-GCNT2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GCNT2, aa1-402 (NP_663630.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(GCNT2 rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.)
Western Blot (WB)
(GCNT2 rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.)
Western Blot (WB)
(Western Blot analysis of GCNT2 expression in transfected 293T cell line by GCNT2 polyclonal antibody. Lane 1: GCNT2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GCNT2 expression in transfected 293T cell line by GCNT2 polyclonal antibody. Lane 1: GCNT2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GCNT2 antibody
GCNT2 is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase that converts linear into branched poly-N-acetyllactosaminoglycans and is responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding 3 different isoforms have been described.
Product Categories/Family for anti-GCNT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
GCNT2 protein
NCBI Official Synonym Full Names
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)<
NCBI Official Symbol
GCNT2
NCBI Protein Information
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; glucosaminyl (N-acetyl) transferase 2, I-branching enzymeN
Similar Products
Product Notes
The GCNT2 (Catalog #AAA6013171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Isoform A, N-acetylglucosaminyltransferase, I-branching Enzyme, IGNT, GCNT5, II, NACGT1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCNT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GCNT2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNFWRYCFFA FTLLSVVIFV RFYSSQLSPP KSYEKLNSSS ERYFRKTACN HALEKMPVFL WENILPSPLR SVPCKDYLTQ NHYITSPLSE EEAAFPLAYV MVIHKDFDTF ERLFRAIYMP QNVYCVHVDE KAPAEYKESV RQLLSCFQNA FIASKTESVV YAGISRLQAD LNCLKDLVAS EVPWKYVINT CGQDFPLKTN REIVQHLKGF KGKNITPGVL PPDHAIKRTK YVHQEHTDKG GFFVKNTNIL KTSPPHQLTI YFGTAYVALT RDFVDFVLRD QRAIDLLQWS KDTYSPDEHF WVTLNRVSGV PGSMPNASWT GNLRAIKWSD MEDRHGGCHG HYVHGICIYG NGDLKWLVNS PSLFANKFEL NTYPLTVECL ELRHRERTLN QSETAIQPSW YF. It is sometimes possible for the material contained within the vial of "GCNT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
