Rabbit anti-Human GCNT2 Polyclonal Antibody | anti-GCNT2 antibody

GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, Isoform A, N-acetylglucosaminyltransferase, I-branching Enzyme, IGNT, GCNT5, II, NACGT1) (HRP)

Cat. Num. AAA6379630

• Gene Names: GCNT2; II; CCAT; IGNT; ULG3; GCNT5; GCNT2C; NACGT1; NAGCT1; CTRCT13; bA421M1.1; bA360O19.2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GCNT2; Polyclonal Antibody; GCNT2 (N-acetyllactosaminide beta-1; 6-N-acetylglucosaminyl-transferase; Isoform A; N-acetylglucosaminyltransferase; I-branching Enzyme; IGNT; GCNT5; II; NACGT1) (HRP); anti-GCNT2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GCNT2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 402

• Applicable Applications for anti-GCNT2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human GCNT2, aa1-402 (NP_663630.2).
• Immunogen Sequence: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GCNT2 rabbit polyclonal antibody. Western Blot analysis of GCNT2 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of GCNT2 expression in transfected 293T cell line by GCNT2 polyclonal antibody. Lane 1: GCNT2 transfected lysate (46.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-GCNT2 antibody

GCNT2 is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase that converts linear into branched poly-N-acetyllactosaminoglycans and is responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding 3 different isoforms have been described.

Product Categories/Family for anti-GCNT2 antibody

Antibodies; Enzymes; Glycosyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 85790495
• NCBI GeneID: 2651
• NCBI Accession #: NP_663630.2
• NCBI GenBank Nucleotide #: NM_145655.3
• UniProt Accession #: Q8N0V5
• NCBI Official Full Name: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform C
• NCBI Official Synonym Full Names: glucosaminyl (N-acetyl) transferase 2 (I blood group)
• NCBI Official Symbol: GCNT2
• NCBI Official Synonym Symbols: II; CCAT; IGNT; ULG3; GCNT5; GCNT2C; NACGT1; NAGCT1; CTRCT13; bA421M1.1; bA360O19.2
• NCBI Protein Information: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
• UniProt Protein Name: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform A
• Protein Family: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase
• UniProt Gene Name: GCNT2
• UniProt Synonym Gene Names: GCNT5; II; NACGT1; N-acetylglucosaminyltransferase
• UniProt Entry Name: GNT2A_HUMAN

NCBI Description

This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

GCNT2A: Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. The expression of the blood group I antigen in erythrocytes is determined by isoform C. Belongs to the glycosyltransferase 14 family. 3 isoforms of the human protein are produced by alternative splicing

Protein type: EC 2.4.1.150

Chromosomal Location of Human Ortholog: 6p24.2

Cellular Component: Golgi membrane; membrane; integral to membrane

Molecular Function: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity

Biological Process: glycosaminoglycan biosynthetic process; positive regulation of protein kinase B signaling cascade; positive regulation of heterotypic cell-cell adhesion; multicellular organismal development; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; protein amino acid glycosylation; positive regulation of cell migration

Disease: Blood Group, I System