Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Rabbit GBP2 Polyclonal Antibody | anti-GBP2 antibody

GBP2 antibody - N-terminal region

Reactivity
Cow, Guinea Pig, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GBP2; Polyclonal Antibody; GBP2 antibody - N-terminal region; anti-GBP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE
Sequence Length
591
Applicable Applications for anti-GBP2 antibody
Western Blot (WB)
Homology
Cow: 83%; Guinea Pig: 83%; Human: 100%; Rabbit: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-GBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-GBP2 antibody
This is a rabbit polyclonal antibody against GBP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GBPs are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP). GBP2 is a GTPase that converts GTP to GDP and GMP.
Product Categories/Family for anti-GBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
guanylate-binding protein 2
NCBI Official Synonym Full Names
guanylate binding protein 2
NCBI Official Symbol
GBP2
NCBI Protein Information
guanylate-binding protein 2
UniProt Protein Name
Guanylate-binding protein 2
Protein Family
UniProt Gene Name
GBP2
UniProt Synonym Gene Names
GBP-2; HuGBP-2
UniProt Entry Name
GBP2_HUMAN

NCBI Description

This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may play a role as a marker of squamous cell carcinomas. [provided by RefSeq, Jul 2013]

Uniprot Description

GBP2: a member of the family of large GTP-binding proteins (GBPs) that is inducible by interferon. Possesses a high GTP hydrolysis activity. GBPs are the most abundant cellular proteins expressed in response to interferon-gamma (IFN-gamma). IFN-gamma, tumor necrosis factor-alpha (TNF-alpha), and interleukin-1beta (IL-1beta) strongly induce the expression of GBP-1, -2, and -3.

Protein type: Hydrolase; Vesicle

Chromosomal Location of Human Ortholog: 1p22.2

Cellular Component: cytosol; Golgi membrane; perinuclear region of cytoplasm

Molecular Function: GTP binding; GTPase activity; protein binding

Biological Process: cytokine and chemokine mediated signaling pathway; immune response; metabolic process

Research Articles on GBP2

Similar Products

Product Notes

The GBP2 gbp2 (Catalog #AAA3211820) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GBP2 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GBP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GBP2 gbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HYVTELTDRI KANSSPGNNS VDDSADFVSF FPAFVWTLRD FTLELEVDGE. It is sometimes possible for the material contained within the vial of "GBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.