Western Blot (WB)
(WB Suggested Anti-GATC AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Rabbit GATC Polyclonal Antibody | anti-GATC antibody
GATC antibody - N-terminal region
Gene Names
GATC; 15E1.2
Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GATC; Polyclonal Antibody; GATC antibody - N-terminal region; anti-GATC antibody
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLE
Sequence Length
136
Applicable Applications for anti-GATC antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Pig: 92%; Rabbit: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GATC AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-GATC AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-GATC antibody
This is a rabbit polyclonal antibody against GATC. It was validated on Western Blot
Target Description: GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Target Description: GATC allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Product Categories/Family for anti-GATC antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
NCBI Official Synonym Full Names
glutamyl-tRNA amidotransferase subunit C
NCBI Official Symbol
GATC
NCBI Official Synonym Symbols
15E1.2
NCBI Protein Information
glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
UniProt Protein Name
Glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial
Protein Family
UniProt Gene Name
GATC
UniProt Entry Name
GATC_HUMAN
Uniprot Description
GATC: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu- tRNA(Gln). Belongs to the GatC family.
Protein type: EC 6.3.5.-; Mitochondrial
Chromosomal Location of Human Ortholog: 12q24.31
Cellular Component: mitochondrion
Molecular Function: glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity; ATP binding
Biological Process: mitochondrial translation; regulation of translational fidelity
Research Articles on GATC
Similar Products
Product Notes
The GATC gatc (Catalog #AAA3215940) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATC antibody - N-terminal region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GATC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATC gatc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLRAPLGGRQ GFTSKADPQG SGRITAAVIE HLERLALVDF GSREAVARLE. It is sometimes possible for the material contained within the vial of "GATC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
