Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Mouse anti-Human PET112L Monoclonal Antibody | anti-PET112L antibody

PET112L (Glutamyl-tRNA(Gln) Amidotransferase Subunit B, Mitochondrial, Glu-AdT Subunit B, Cytochrome C Oxidase Assembly Factor PET112 Homolog, PET112, HSPC199) (Biotin)

Gene Names
GATB; PET112; HSPC199; PET112L
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PET112L; Monoclonal Antibody; PET112L (Glutamyl-tRNA(Gln) Amidotransferase Subunit B; Mitochondrial; Glu-AdT Subunit B; Cytochrome C Oxidase Assembly Factor PET112 Homolog; PET112; HSPC199) (Biotin); anti-PET112L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B2
Specificity
Recognizes human PET112L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-PET112L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa466-557 from human PET112L (NP_004555) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.75kD).)

Western Blot (WB)

(PET112L monoclonal antibody. Western Blot analysis of PET112L expression in HeLa)

Western Blot (WB) (PET112L monoclonal antibody. Western Blot analysis of PET112L expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged PET112L is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PET112L is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-PET112L antibody
Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Product Categories/Family for anti-PET112L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutamyl-tRNA amidotransferase subunit B
NCBI Official Symbol
GATB
NCBI Official Synonym Symbols
PET112; HSPC199; PET112L
NCBI Protein Information
glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
UniProt Protein Name
Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
UniProt Gene Name
GATB
UniProt Synonym Gene Names
Glu-AdT subunit B

Uniprot Description

PET112L: Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu- tRNA(Gln). Belongs to the GatB/GatE family. GatB subfamily.

Protein type: EC 6.3.5.-; Ligase; Mitochondrial; RNA-binding; Translation

Chromosomal Location of Human Ortholog: 4q31.3

Cellular Component: mitochondrion

Molecular Function: ATP binding; glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity; translation factor activity, nucleic acid binding

Biological Process: mitochondrial translation; translation

Research Articles on PET112L

Similar Products

Product Notes

The PET112L gatb (Catalog #AAA6143487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PET112L (Glutamyl-tRNA(Gln) Amidotransferase Subunit B, Mitochondrial, Glu-AdT Subunit B, Cytochrome C Oxidase Assembly Factor PET112 Homolog, PET112, HSPC199) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PET112L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PET112L gatb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PET112L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.