Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Gatad2b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Gatad2b Polyclonal Antibody | anti-GATAD2B antibody

Gatad2b antibody - C-terminal region

Gene Names
Gatad2b; P66beta; AL118180; mKIAA1150; C430014D17Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Gatad2b; Polyclonal Antibody; Gatad2b antibody - C-terminal region; anti-GATAD2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKAPSLADRQREYLLDM
Sequence Length
594
Applicable Applications for anti-GATAD2B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Gatad2b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Gatad2b AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-GATAD2B antibody
This is a rabbit polyclonal antibody against Gatad2b. It was validated on Western Blot

Target Description: Gatad2b has transcriptional repressor activity. Gatad2b targets MBD3 to discrete loci in the nucleus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
transcriptional repressor p66-beta
NCBI Official Synonym Full Names
GATA zinc finger domain containing 2B
NCBI Official Symbol
Gatad2b
NCBI Official Synonym Symbols
P66beta; AL118180; mKIAA1150; C430014D17Rik
NCBI Protein Information
transcriptional repressor p66-beta
UniProt Protein Name
Transcriptional repressor p66-beta
Protein Family
UniProt Gene Name
Gatad2b
UniProt Entry Name
P66B_MOUSE

Research Articles on GATAD2B

Similar Products

Product Notes

The GATAD2B gatad2b (Catalog #AAA3204621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gatad2b antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Gatad2b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATAD2B gatad2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSNFAQAPQL SVPGGLLGMP GVNIAYLNTG IGGHKAPSLA DRQREYLLDM. It is sometimes possible for the material contained within the vial of "Gatad2b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.