Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

Rabbit RB1 Polyclonal Antibody | anti-RB1 antibody

RB1 antibody - C-terminal region

Gene Names
RB1; RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RB1; Polyclonal Antibody; RB1 antibody - C-terminal region; anti-RB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSI
Sequence Length
928
Applicable Applications for anti-RB1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human RB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

Western Blot (WB) (WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRB1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)
Related Product Information for anti-RB1 antibody
This is a rabbit polyclonal antibody against RB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Retinoblastoma (RB) is an embryonic malignant neoplasm of retinal origin. It almost always presents in early childhood and is often bilateral. Spontaneous regression ('cure') occurs in some cases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
retinoblastoma-associated protein
NCBI Official Synonym Full Names
RB transcriptional corepressor 1
NCBI Official Symbol
RB1
NCBI Official Synonym Symbols
RB; pRb; OSRC; pp110; p105-Rb; PPP1R130
NCBI Protein Information
retinoblastoma-associated protein
UniProt Protein Name
Retinoblastoma-associated protein
UniProt Gene Name
RB1
UniProt Synonym Gene Names
Rb
UniProt Entry Name
RB_HUMAN

NCBI Description

The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma. [provided by RefSeq, Jul 2008]

Uniprot Description

Rb: retinoblastoma tumor suppressor protein regulates cell proliferation by controlling progression through the G1-phase restriction point. Has three distinct binding domains and interacts with regulatory proteins including the E2F family of transcription factors, c-Abl tyrosine kinase and proteins with a conserved LXCXE motif. Cell cycle-dependent phosphorylation by Cdks inhibits Rb target binding, thus allowing cell cycle progression. Recruits and targets histone methyltransferase suv39h1 leading to epigenetic transcriptional repression.

Protein type: Transcription, coactivator/corepressor; Oncoprotein; Nuclear receptor co-regulator; Tumor suppressor

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: nucleoplasm; SWI/SNF complex; PML body; Rb-E2F complex; spindle; chromatin; nucleus

Molecular Function: identical protein binding; protein binding; androgen receptor binding; DNA binding; ubiquitin protein ligase binding; transcription coactivator activity; phosphoprotein binding; kinase binding; transcription factor binding; transcription factor activity

Biological Process: sister chromatid biorientation; viral reproduction; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter, mitotic; regulation of mitotic cell cycle; neuron maturation; positive regulation of macrophage differentiation; cell cycle arrest; neurite development; negative regulation of epithelial cell proliferation; transcription, DNA-dependent; mitotic cell cycle checkpoint; negative regulation of transcription factor activity; regulation of lipid kinase activity; enucleate erythrocyte differentiation; G1/S-specific transcription in mitotic cell cycle; chromatin remodeling; myoblast differentiation; neuron apoptosis; maintenance of mitotic sister chromatid cohesion; gut development; cell division; neuron morphogenesis during differentiation; negative regulation of smoothened signaling pathway; androgen receptor signaling pathway; Ras protein signal transduction; positive regulation of mitotic metaphase/anaphase transition; negative regulation of protein kinase activity; striated muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; negative regulation of transcription, DNA-dependent; cell cycle checkpoint; G1/S transition of mitotic cell cycle

Disease: Bladder Cancer; Osteogenic Sarcoma; Small Cell Cancer Of The Lung; Retinoblastoma

Research Articles on RB1

Similar Products

Product Notes

The RB1 rb1 (Catalog #AAA3201388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RB1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RB1 rb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IMMCSMYGIC KVKNIDLKFK IIVTAYKDLP HAVQETFKRV LIKEEEYDSI. It is sometimes possible for the material contained within the vial of "RB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.