Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GATA4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GATA4 Polyclonal Antibody | anti-GATA4 antibody

GATA4 Antibody - N-terminal region

Gene Names
GATA4; TOF; ASD2; VSD1; TACHD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GATA4; Polyclonal Antibody; GATA4 Antibody - N-terminal region; anti-GATA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGL
Sequence Length
442
Applicable Applications for anti-GATA4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of Human GATA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GATA4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GATA4Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GATA4 antibody
This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-GATA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
transcription factor GATA-4 isoform 1
NCBI Official Synonym Full Names
GATA binding protein 4
NCBI Official Symbol
GATA4
NCBI Official Synonym Symbols
TOF; ASD2; VSD1; TACHD
NCBI Protein Information
transcription factor GATA-4
UniProt Protein Name
Transcription factor GATA-4
Protein Family
UniProt Gene Name
GATA4
UniProt Entry Name
GATA4_HUMAN

NCBI Description

This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

GATA4: a conserved and ubiquitous member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function. May regulate a set of cardiac-specific genes and play a crucial role in cardiogenesis. Defects are a cause of atrial septal defect 2 (ASD2). ASD2 is an autosomal dominant condition with atrial septal defect and other congenital heart disease but no conduction defects or noncardiac abnormalities.

Protein type: Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p23.1-p22

Cellular Component: nucleoplasm; nuclear chromatin; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; NFAT protein binding; transcription activator binding; DNA binding; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: cardiac muscle hypertrophy; transcription from RNA polymerase II promoter; negative regulation of autophagy; positive regulation of transcription, DNA-dependent; embryonic heart tube anterior/posterior pattern formation; Sertoli cell differentiation; Wnt receptor signaling pathway through beta-catenin; BMP signaling pathway; regulation of transcription, DNA-dependent; cell-cell signaling; embryonic digestive tract morphogenesis; embryonic foregut morphogenesis; heart looping; positive regulation of BMP signaling pathway; positive regulation of cardiac muscle cell proliferation; response to drug; response to retinoic acid; in utero embryonic development; male gonad development; gastrulation with mouth forming second; positive regulation of angiogenesis; response to estrogen stimulus; response to mechanical stimulus; endoderm formation; positive regulation of cardioblast differentiation; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; blood coagulation; endoderm development

Disease: Ventricular Septal Defect 1; Tetralogy Of Fallot; Atrial Septal Defect 2; Atrioventricular Septal Defect 4; Testicular Anomalies With Or Without Congenital Heart Disease

Research Articles on GATA4

Similar Products

Product Notes

The GATA4 gata4 (Catalog #AAA3223035) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA4 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GATA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GATA4 gata4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQSLAMAANH GPPPGAYEAG GPGAFMHGAG AASSPVYVPT PRVPSSVLGL. It is sometimes possible for the material contained within the vial of "GATA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.