Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GALNT7Sample Tissue: Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GALNT7 Polyclonal Antibody | anti-GALNT7 antibody

GALNT7 Antibody - N-terminal region

Gene Names
GALNT7; GalNAcT7; GALNAC-T7
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GALNT7; Polyclonal Antibody; GALNT7 Antibody - N-terminal region; anti-GALNT7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: LLVVGSFLGLVVLWSSLTPRPDDPSPLSRMREDRDVNDPMPNRGGNGLAP
Sequence Length
657
Applicable Applications for anti-GALNT7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GALNT7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GALNT7Sample Tissue: Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GALNT7Sample Tissue: Breast Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GALNT7 antibody
This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.
Product Categories/Family for anti-GALNT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72 kDa
NCBI Official Full Name
N-acetylgalactosaminyltransferase 7
NCBI Official Synonym Full Names
polypeptide N-acetylgalactosaminyltransferase 7
NCBI Official Symbol
GALNT7
NCBI Official Synonym Symbols
GalNAcT7; GALNAC-T7
NCBI Protein Information
N-acetylgalactosaminyltransferase 7
UniProt Protein Name
N-acetylgalactosaminyltransferase 7
UniProt Gene Name
GALNT7
UniProt Synonym Gene Names
GalNAc-T7; pp-GaNTase 7
UniProt Entry Name
GALT7_HUMAN

NCBI Description

This gene encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation. [provided by RefSeq, Jul 2008]

Uniprot Description

GALNT7: a glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. A single-pass type II membrane protein that localizes to the Golgi apparatus membrane. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties.

Protein type: EC 2.4.1.-; Glycan Metabolism - O-glycan biosynthesis; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q31.1

Cellular Component: Golgi membrane; membrane; integral to membrane

Molecular Function: metal ion binding; polypeptide N-acetylgalactosaminyltransferase activity; carbohydrate binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; carbohydrate metabolic process; post-translational protein modification

Research Articles on GALNT7

Similar Products

Product Notes

The GALNT7 galnt7 (Catalog #AAA3220664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GALNT7 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GALNT7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GALNT7 galnt7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLVVGSFLGL VVLWSSLTPR PDDPSPLSRM REDRDVNDPM PNRGGNGLAP. It is sometimes possible for the material contained within the vial of "GALNT7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.